Topic:"Infrastructure Planning" in M08929

releases additional 8760 energy savings data reflective of Navigant’s “Base Case” scenario. o August 2, 2019: Reply to stakeholder comments released to DSMAG. Throughout each phase of the Potential Study development EfficiencyOne received...

AI summary EfficiencyOne's DSM Potential Study incorporated stakeholder feedback during development, resulting in a comprehensive report to inform the 2020 Integrated Resource Plan. The process included multiple engagement phases with DSMAG and detailed documentation of comment incorporation in Appendix A.

Page iii ©2019 Navigant Consulting, Ltd. Nova Scotia Energy Efficiency and Demand Response Potential Study for 2021-2045 E. EXECUTIVE SUMMARY EfficiencyOne engaged Navigant Consulting, Inc. (Navigant) to prepare energy efficiency (EE) and...

AI summary EfficiencyOne commissioned Navigant Consulting to assess Nova Scotia's energy efficiency (EE) and demand response (DR) potential from 2021-2045. The study uses Navigant's DSMSim™ model to analyze technical, economic, and market savings across residential and business/nonprofit sectors, informing integrated resource planning (IRP) and program design.

tates, and our DSM potential studies and models have been quoted by ACEEE as being “robust and transparent… [and] their methodology for forecasting participation is industry standard best-practice.” 6 As is typical in the development of su...

AI summary Navigant was commissioned by EfficiencyOne to estimate the potential for electric energy efficiency and demand response in Nova Scotia from 2021 to 2045. The study involved collaboration with stakeholders through the DSMAG and aimed to inform integrated resource planning and program design.

1. Energy Efficiency (EE) Potential Study for the 25-year period 2021 to 2045 2. Demand Response (DR) Potential Study for the 25-year period 2021 to 2045 The main objective of the studies is to identify and quantify electricity and/or dema...

AI summary This document outlines the methodology for conducting energy efficiency (EE) and demand response (DR) potential studies for Nova Scotia Power (NSP) over a 25-year period from 2021 to 2045. The studies aim to identify and quantify electricity and demand savings, disaggregated by sector and end use, to inform the development of NSP’s next Integrated Resource Plan (IRP).

One requires estimates of demand-side management (DSM) potential energy and winter peak demand savings for a 25-year period (2021 through 2045) to inform the development of this IRP. Navigant is developing a 25-year DSM potential analysis...

AI summary The document outlines the need for a 25-year DSM potential analysis to inform the Integrated Resource Plan (IRP) in Nova Scotia. Navigant, in collaboration with Narrative Research, is conducting a market assessment to update baseline energy-consuming equipment and building stock data. The study aims to develop sector-specific customer data and payback acceptance curves to support energy efficiency potential studies.

true distribution of key demographic characteristics of the population. Data collection took place from April 16 to April 24, 2019, with an average survey length of thirteen minutes. 1.5 Business, Nonprofit and Institutional Sector Online...

AI summary The document outlines the methodology used for two surveys conducted in Nova Scotia in 2019: one targeting the residential sector and another focusing on the Business, Nonprofit, and Institutional (BNI) sector. Both surveys collected demographic and energy-related data to support the Integrated Resource Plan (IRP).

1 TABLE OF FIGURES 2 Figure 1: Location of NS Power Hydro Systems .......................................................................................... 6 3 Figure 2: Summary of forecast sustaining and decommissioning costs of NS Power...

AI summary This table of figures outlines the location, sustaining and decommissioning costs, and system costs for NS Power hydro systems, including Annapolis Tidal, Avon, Bear River, and Black River. It provides forecasts and watershed details for these hydro systems as part of a regulatory proceeding.

26 14 Figure 13: Black River decommissioning forecast ..................................................................................... 26 15 Figure 14: Black River Hydro System ............................................................

AI summary The text lists figures related to hydroelectric systems (Black River, Dickie Brook, Fall River, Harmony, Lequille) with sustaining and decommissioning forecasts. These figures likely address infrastructure planning and asset management for hydroelectric projects in Nova Scotia.

............................................................................................................ 35 27 Figure 26: Mersey sustaining forecast .........................................................................................

AI summary The text lists figures related to hydroelectric systems (Mersey, Nictaux, Paradise, Roseway, Sheet Harbour) with sustaining/decommissioning forecasts and system descriptions, focusing on infrastructure planning and operational timelines for these facilities.

........................................................................................ 44 39 Figure 38: Sheet Harbour decommissioning forecast ................................................................................. 44 40 Figure...

AI summary The text lists figures related to hydro asset decommissioning and sustaining forecasts for Sheet Harbour and Sissiboo systems, part of a redacted 'Hydro Asset Study.' The content focuses on infrastructure planning and asset management for hydroelectric systems.

1 Figure 42: Sissiboo Hydro System.............................................................................................................. 47 2 Figure 43: St. Margaret’s Bay sustaining forecast ..........................................

AI summary The document lists figures and appendices related to hydro system sustaining/decommissioning forecasts for Sissiboo, St. Margaret’s Bay, Tusket, and Wreck Cove, along with appendices containing reports on hydro planning, decommissioning costs, and wetland permitting. Appendices reference METSCO, Hatch, Yates, and Strum reports.

6 REDACTED (CONFIDENTIAL INFORMATION REMOVED) Hydro Asset Study REDACTED

AI summary The document references a 'Hydro Asset Study' with significant redactions, indicating confidential information has been removed. The content focuses on asset-related analysis but lacks detailed discussion due to redaction.

1 The Hydro Study outlines the assumptions and methodology used to determine these 2 values. The assumptions outline inclusions and exclusions pursued for the Hydro Study. 3 4 The Hydro Study, which includes Appendices A - F, provides the...

AI summary The Hydro Study details NS Power's methodology for calculating sustaining and decommissioning costs of hydro systems, including forecasted expenses and their inclusion in an Integrated Resource Plan (IRP). Costs outlined do not account for replacement energy or system-wide value, which will be addressed in the IRP process.

34 Black River $47,350,000 $194,690,000 94 Dickie Brook $5,400,000 $33,020,000 8 Fall River $3,910,000 $6,500,000 2 Harmony $5,360,000 Lequille $8,330,000 $10,000,000 25 Mersey $355,730,000 $213,560,000 231 Nictaux $6,240,000 $28,190,000 4...

AI summary The text presents a table of hydro asset-related financial figures (e.g., Black River, Mersey) with associated numbers, followed by a redacted 'Hydro Asset Study' section. Confidential information has been removed, and the document appears to relate to infrastructure planning or capital expenditures in Nova Scotia's energy sector.

8 REDACTED (CONFIDENTIAL INFORMATION REMOVED) Hydro Asset Study REDACTED

AI summary The document is a redacted Hydro Asset Study, with confidential information removed. The content focuses on infrastructure planning and asset management related to hydroelectric resources, though specific details are not disclosed.

1 2 Unless stated otherwise, all sustaining costs are estimated based on the requirement to 3 keep hydro systems operating as they presently do in 2018 dollars. Annual spend 4 estimates represent project costs allocated to the in-service y...

AI summary The text outlines sustaining costs for hydro systems, estimated in 2018 dollars, including administrative overheads and AFUDC. A 40-year horizon is used for cost extraction, not decommissioning. Specific systems like Annapolis and Mersey are noted as subjects of regulatory filings.

1 2 2.2.2 Operational Costs 3 4 It was assumed that the operations staffing, maintenance and support costs will remain 5 constant with regard to the hydro fleet. Unless otherwise noted, the average of the past 6 five years of available hyd...

AI summary The text outlines assumptions about hydro operational costs, replacement energy costs (REC), and decommissioning costs. Operational costs are projected at $59.68M over 40 years, while REC is tied to IRP analysis. Generation cost benefits are excluded from the Hydro Study, focusing instead on avoided replacement energy costs for capital projects.

from 20 the decommissioning of a hydro system are not included in the Hydro Study. 21 Determining these costs would require further site-specific analyses. 22 23 For the purposes of this Hydro Study, the estimated decommissioning costs ass...

AI summary The Hydro Study excludes decommissioning costs of a hydro system, assuming restoration to natural conditions. However, the Hatch Report highlights that mitigation measures for dam removal may not always succeed, leading to long-term remediation costs. Site-specific analyses are needed for accurate decommissioning cost estimates.

1 surge tanks, canals, fish passages and other water control infrastructure. Dams are a 2 variety of ages, sizes, and were built using a variety of construction methodologies and 3 materials. At such a stage, the methodology in the Hatch R...

AI summary The text discusses the costs associated with the removal and stabilization of NS Power’s hydro powerhouses, referencing the Hatch and Yates Reports. It highlights the methodology used for estimating costs, including environmental and structural considerations for each powerhouse.

6 REDACTED (CONFIDENTIAL INFORMATION REMOVED) Hydro Asset Study REDACTED

AI summary The document references a 'Hydro Asset Study' with significant redactions, indicating confidential information has been removed. The content focuses on asset-related analysis but lacks detailed discussion due to redaction.

city 23.0 MW REDACTED (CONFIDENTIAL INFORMATION REMOVED) Hydro Asset Study REDACTED 1 3.4 Dickie Brook Hydroelectric System 2 3 The Dickie Brook hydro system, outside of Guysborough, NS, was built in the 1940s and 4 is comprised of one pow...

AI summary The Dickie Brook hydro system, built in the 1940s and located outside of Guysborough, NS, has a total capacity of 3.1 MW. The document provides forecasts for sustaining capital, operating costs, and decommissioning expenses, including environmental and archaeological considerations.

Tusket Hydro System REDACTED (CONFIDENTIAL INFORMATION REMOVED) Hydro Asset Study REDACTED 1 3.16 Wreck Cove Hydroelectric System 2 3 The Wreck Cove hydro system, shown below in Figure 51 has a maximum capacity of 4 215.8 MW, across three...

AI summary The Wreck Cove hydro system has a maximum capacity of 215.8 MW and consists of three units across two powerhouses. The document outlines sustaining capital, LEM, and operating costs totaling $160.12 million, as well as decommissioning costs estimated at $424.94 million, including removal, environmental, sedimentation, archaeology, and AO/AFUDC costs.

1 4.0 BATTERY STORAGE 2 3 In its Decision regarding the 2018 Annual Capital Expenditure plan, the UARB stated as 4 follows: 5 6 The Board appreciates the current limitation and challenges related to 7 battery storage. Given potentially rap...

AI summary The document discusses battery storage challenges and considerations for NS Power in its Integrated Resource Plan, highlighting the importance of assessing battery storage's role in providing firm dispatchable renewable energy and the impact of storage duration on capacity provision.

54 REDACTED (CONFIDENTIAL INFORMATION REMOVED) Hydro Asset Study REDACTED 1 study being conducted to evaluate the capacity contribution of wind in preparation for the 2 next IRP. 3 4 The information provided in the Hydro Asset Study, inclu...

AI summary The Hydro Asset Study is being conducted to evaluate the capacity contribution of wind energy in preparation for the next Integrated Resource Plan (IRP). The study will compare the costs of new renewable resources with the costs of maintaining or refurbishing existing hydro assets. The UARB has directed NS Power to complete the IRP by mid-2020 and related analyses by July 31, 2019.

55 REDACTED (CONFIDENTIAL INFORMATION REMOVED) Hydro Asset Study REDACTED 1 5.0 CONCLUSION 2 3 The Hydro Study provides forecast sustaining capital and operating costs and 4 decommissioning costs of each of NS Power’s hydro systems. NS Pow...

AI summary The Hydro Study outlines forecasted sustaining capital, operating, and decommissioning costs for NS Power’s hydro systems. Expert consultants were engaged to estimate costs related to physical removal, environmental assessment, sediment management, and archaeology. NS Power is also preparing for its next Integrated Resource Plan (IRP) by evaluating storage technologies and renewable energy options.

................................................15 Appendix A: Investigators Short Bio ............................................................................................................16 1 REDACTED (CONFIDENTIAL INFORMATION REMO...

AI summary The document provides an overview of NS Power's Hydro Asset Management Spending Plan, including historical spending trends and a 10-year outlook for hydro fleet management across river systems, as part of a hydro asset study conducted in December 2018.

ovided by NS Power. Among other factors, METSCO considered the completeness of asset registry, life-cycle cost estimates, and investment optimization and prioritization frameworks underlying the Plan. The HIP covers NS Power’s major hydroe...

AI summary The document discusses the evaluation of NS Power's Hydro Interval Plan (HIP) by METSCO, highlighting its asset management practices, including proactive risk management and life-cycle cost estimates. The HIP spans 40 years and uses two intervention intervals for analyzing major hydroelectric assets. METSCO found NS Power's approach to be comparable to other utilities and noted that detailed assessments will refine long-term capital spending profiles.

ower’s Renewable Energy Strategy to meet government policy requirements reflecting the public’s desire for cleaner and renewable electricity (40% renewable energy is mandated by 2020). • Reliability – a number of existing hydro assets are...

AI summary NS Power is investing in its hydroelectric infrastructure to meet renewable energy targets, improve reliability, and enhance flexibility for integrating variable energy sources. The Asset Management team is working on long-term capital planning to modernize the aging hydro fleet.

of 22 December 2018 Review of NS Power Hydro Asset Management Spending Plan • Decommissioning any aspects of the hydro fleet that is not economic or feasible to modernize or extend life (retirement). The Hydro Interval Plan (HIP) is the pr...

AI summary The document outlines the purpose and scope of METSCO Energy Solutions Inc.'s review of NS Power's Hydro Asset Management Spending Plan, which includes assessing alignment with modern asset management practices and identifying opportunities for improvement.

he outer years, and review of consideration being given to analysis of alternatives and options, as well as cost-benefit analysis to maximize the value from utilizing the hydro assets. • Other considerations – additional factors noted by M...

AI summary The document discusses the review of NS Power’s Hydro Interval Plan, focusing on asset management practices, forecasting capital needs for the hydro fleet over the next 40 years, and the absence of benchmarking against ISO 55001 and PAS 55 standards. It also notes considerations such as asset management principles, demand analysis, and stakeholder engagement.

x x x x x x x x x x Wreck Cove x x x x x x x x x x x x x x x BOP Balance of Plants & Tools/Equipment PS Penstock CN Crane ST Structures (Separate from Dam) EL Electrics TL Tailrace GR Generator Rotor TR Turbine & Components GS Generator St...

AI summary The document discusses NS Power's Hydro Interval Plan (HIP), which is based on life-cycle cost estimates and intervals for replacing or refurbishing hydro assets. The plan includes major capital-intensive activities such as refurbishment and replacement of individual assets.

lude asset condition and risk assessment practices to be appropriately utilized for NS Power to prioritize the assets in the HIP by addressing the most critical assets in the worst condition first. 11 REDACTED (CONFIDENTIAL INFORMATION REM...

AI summary The document discusses NS Power's historical and future spending on hydro asset management, noting a significant increase in future costs due to the inclusion of redevelopment costs for the Mersey river system, which were not accounted for in historical spending profiles.

omers would experience. Additionally, the HIP determines the first interval upgrades for governors and I&C based on the work performed for electrics such as power transformer, circuit breaker and bus. METSCO finds the labour resource and o...

AI summary The document discusses the Hydro Interval Plan (HIP) and its impact on labour resource and operational constraints, as well as a 10-year capital expenditure outlook for NS Power, including upgrades for governors and I&C based on electric work.

8M $8.8M $7.8M $2.4M $1.0M $0.8M $0.4M $1.8M $0.8M Total $35.9M $45.5M $47.7M $36.6M $13.2M $21.0M $16.1M $4.5M $4.9M $4.0M 14 REDACTED (CONFIDENTIAL INFORMATION REMOVED) Hydro Asset Study Appendix A Page 20 of 22 December 2018 Review of N...

AI summary This document provides a conclusion from METSCO's review of NS Power’s Hydro Interval Plan (HIP). The assessment evaluated the completeness of asset registries, life-cycle cost estimates, and investment prioritization. The HIP focuses on sustainment and modernization of the existing hydro fleet, excluding decommissioning or redevelopment, though NS Power has developed separate plan documents for those areas.

...................................................... 48 Figure 33: The Wreck Cove Hydroelectric System......................................................................... 49 Figure 34: Schematic of the Wreck Cove Generating System ....

AI summary The document includes figures and appendices related to the Wreck Cove Hydroelectric System and infrastructure removal costs. It references detailed cost estimates and environmental considerations for dam decommissioning.

Table 1. Details of the structures are provided in Appendix A. Table 1: Summary of NSPI Structures Structures Total Reservoirs 67 Dams/Intakes/Wingwalls/intakes 150 Spillways/Sluiceways 78 Canals 17 Fishways 11 Powerhouses 30 The objective...

AI summary The study aims to provide a high-level cost estimate for the full decommissioning of NSPI’s waterpower assets, including infrastructure removal and environmental costs. Sediment management costs are also considered based on precedent information, while certain costs are excluded.

with its corporate base in Ontario Canada. Hatch provides consulting engineering and management services to the energy, infrastructure and industrial sectors. In the Energy sector Hatch has a complete compliment of staff that includes prof...

AI summary Hatch Ltd. is a consulting engineering firm based in Ontario, Canada, specializing in hydroelectric facilities and dams. It has extensive experience in planning, designing, constructing, and decommissioning dams, including notable projects such as the Finlayson Dam and Crooks Hollow Dam removals in Ontario.

51.5 622 576,829 MacDonald Pond Power Canal 13.1 1,584 5,034 H357345-00000-200-230-0001, Rev. 0, Page 11 Ver: 04.03 © Hatch 2018 All rights reserved, including all rights relating to the use of this document or its contents. REDACTED (CONF...

AI summary The Bear River Hydroelectric System, built in the 1950s in northwestern Nova Scotia, consists of two power stations, one reservoir, two head ponds, three dams, and a canal. It has a capacity of up to 10 MW of electricity.

Figure: 7b Page: Document Path: T:\Maps\GIS_Data\NSPI\BlackRiver\MXD\BlackRiver_AllStructures.mxd REDACTED (CONFIDENTIAL INFORMATION REMOVED) REDACTED Hydro Asset Study Appendix B Page 23 of 110 7 6 White m 2 Rock Parrsboro Pond Canning Co...

AI summary The text contains a redacted map and location names, including areas such as Parrsboro, Wolfville, and Hantsport, along with references to geographical features like ponds and dams. The content appears to be related to infrastructure planning or mapping.

Brook Dam Aylesford Lake Main Dam Gaspereau Lake  Gaspereau (South) Dyke  Aylesford Lake Two Mile Trout Rive Lake Main Dam

AI summary The text presents a visual representation of geographical features including lakes, dams, and a river, likely related to infrastructure or resource management in Nova Scotia.

CONFIDENTIAL INFORMATION REMOVED) REDACTED Hydro Asset Study Appendix B Page 27 of 110 Nova Scotia Power Inc. Project Management Report Decommissioning Cost Estimate for NSPI Control Project Management Sturctures H357345 NSPI's Hydro Syste...

AI summary This document outlines Nova Scotia Power Inc.'s decommissioning cost estimate for the Black River Generating System, including removal and environmental costs, as well as sediment management allowances.

iver Pond Mid-Pond Dyke and 8 100 Spillway Salmontail Lake Main Dam and Spillway 22 615 3,594,450 Hatchard Lake Dam 8 470 Little River Lake Main Dam and Spillway 15 775 1,609,605 Little River Lake Wing Dam 13 700 1,394,991 Methals Dam and...

AI summary The text lists various dams and spillways in Nova Scotia along with their associated numbers and values, likely related to infrastructure or engineering projects.

58 365 597,138 White Rock Main Dam and Spillway 39 274 850,204 White Rock Canal 30 5,000 23,760 3,597,038 2.8 The Dickie Brook Hydroelectric System The Dickie Brook Hydroelectric System was constructed in southeastern Nova Scotia in the 19...

AI summary The text provides details about the White Rock Main Dam and Spillway, White Rock Canal, and the Dickie Brook Hydroelectric System in Nova Scotia, including their capacities and construction history.

H357345-00000-200-230-0001, Rev. 0, Page 25 Ver: 04.03 © Hatch 2018 All rights reserved, including all rights relating to the use of this document or its contents. REDACTED (CONFIDENTIAL INFORMATION REMOVED) REDACTED Hydro Asset Study Appe...

AI summary The document appears to be a redacted section of a hydro asset study related to the Lequille intake and Bridgetown area, likely involving infrastructure planning or asset management in Nova Scotia.

16 1,180 Lower Great Brook Spillway Left 4 582 Lower Great Brook Spillway Right 4 238 Lower Great Brook Sluiceway 25 170 Lower Great Brook Left Wing Dam 33 436 Lower Great Brook Main Dam 25 923 Lower Great Brook Right Wing Dam 11 365 Deep...

AI summary The text lists various dams and spillways along with their corresponding numbers and capacities, likely related to infrastructure planning or asset management in Nova Scotia.

Project Management Sturctures H357345 NSPI's Hydro System Decommissioning Cost Estimate Exposed Exposed Reservoir Height Length Canal Area Area Structure (ft.) (ft.) (m2) (m2) Nictaux Canal Embankment 60 17,160 129,400 n/a 2.14 The Paradis...

AI summary The document discusses the decommissioning cost estimate for NSPI's Hydro System, specifically focusing on the Nictaux Canal Embankment and the Paradise Hydroelectric System in northwestern Nova Scotia, which was built in the 1980s and has a capacity of 4.8 MW.

REDACTED Hydro Asset Study Appendix B Page 49 of 110 ± 3-25a 3-25b ± 3-25c V U 7

AI summary The text contains redacted pages from a Hydro Asset Study, including technical diagrams or figures labeled 3-25a, 3-25b, 3-25c, and a symbol 'V' and 'U 7'. The content appears to be related to infrastructure or asset planning, but no specific details are provided due to redaction.

7 102 3-29a 7 6 1 6 102 3-29b 7 6 7 6 14 7 7 6 10 3-29c 2 Sherwood 7 610 3 Park 7 63 m Coon Pond Little Indian Lake

AI summary The text appears to be a map or diagram with numerical labels and place names, possibly related to a geographic or infrastructure planning context. It does not contain explicit regulatory discussion or arguments.

D-8-6 22 620 188,820 D-8-7 9.8 341 84,111 D-9 Wreck Cove Brook and Spillway 51.8 861 444,584 D-10 Long Lake 33.1 1,170 284,088 D-11-1 Surge Lake 76.1 611 206,992 D-11-2 44 1,594 119,680 D-11-3 17.1 145 46,512 South Lake Dam and Spillway 12...

AI summary The document outlines various dam and reservoir systems, including their identifiers, sizes, and associated costs. It also discusses the estimation of newly exposed areas if these systems were decommissioned, using GIS-based imagery and assumptions for canal exposure.

These costs are assumed to cover any clearing required as well as road maintenance for the duration of construction. x Cofferdams and Dewatering In general, it was assumed all dams, spillways and overflows would be removed in the wet. Ther...

AI summary The text discusses costs related to construction activities, including cofferdams, dewatering, and the demolition of embankment dams. It notes assumptions made about the removal of structures and the inclusion of associated costs in previous estimates.

guidelines with the exception of the St. Margarets Systems were the level of engineering performed permitted the selection of a 30% contingency. 3.2.4 Direct Costs Based on Precedent Experience For the remaining systems, infrastructure rem...

AI summary The document discusses infrastructure removal costs for systems, excluding the St. Margarets Systems, based on precedent experience and adjusted for length and volume discounts. It outlines a methodology for estimating costs, including contingency and escalation to 2018 $CDN.

n, management and removal of reservoir sediments (quantity and quality of sediments is unknown). x Hazardous material abatement (lead, asbestos). x Large scale re-vegetation measures of the newly exposed reservoir slopes or exposed canal s...

AI summary The text outlines various environmental and infrastructure-related measures required for a project, including sediment management, hazardous material abatement, re-vegetation, and archaeological consulting. It also discusses the significant cost implications of sediment management, which could exceed 50% of infrastructure removal costs.

x Infrastructure Removal costs 30% x Environmental Engineering 22% x Sediment Management 48%. For a detailed assessment of these costs for each of NSPI’s reservoirs, a reliable estimate of costs would require extensive research. For this a...

AI summary The text outlines preliminary cost estimates for infrastructure removal, environmental engineering, and sediment management for NSPI’s reservoirs, based on information provided by NSPI and criteria in Table 23. A detailed assessment would require extensive research.

H357345-00000-200-230-0001, Rev. 0, Page A-1 Ver: 04.03 © Hatch 2018 All rights reserved, including all rights relating to the use of this document or its contents. REDACTED (CONFIDENTIAL INFORMATION REMOVED) REDACTED Hydro Asset Study App...

AI summary The document contains a redacted section of a Hydro Asset Study Appendix B, which includes structural and spillway data for a dam, likely related to infrastructure planning or asset management.

7RWDO (TXLYOHQWQXPEHURI &UHVW ,QIDVWUXFWXUH džƉŽƐĞĚ dŽƚĂů 6\VWHP 'HYHORSPHQW ŽƌĞDĂƚĞƌŝĂů 3XUSRVH +HLJKW >ĞŶŐƚŚ 7RSRI &UHVW /HQJWK )RXQGDWLRQ VWUXFWXUHV EHQFKPDUNLQJ  džƉŽƐĞĚĂƌĞĂ ^ŝƚĞZĞƐƚŽƌĂƚŝŽŶ ŶǀŝƌŽŶŵĞŶƚĂů ŶǀŝƌŽŶŵĞŶ...

AI summary The text presents a table with columns related to infrastructure development, including system development, purpose, height, length, foundation structures, and removal costs. It includes technical terms such as elevation, core, and normal benchmarking. The table contains unspecified data, likely related to engineering or construction projects.

7RWDO (TXLYOHQWQXPEHURI &UHVW ,QIDVWUXFWXUH džƉŽƐĞĚ dŽƚĂů 6\VWHP 'HYHORSPHQW ŽƌĞDĂƚĞƌŝĂů 3XUSRVH +HLJKW >ĞŶŐƚŚ 7RSRI &UHVW /HQJWK )RXQGDWLRQ VWUXFWXUHV EHQFKPDUNLQJ  džƉŽƐĞĚĂƌĞĂ ^ŝƚĞZĞƐƚŽƌĂƚŝŽŶ ŶǀŝƌŽŶŵĞŶƚĂů ŶǀŝƌŽŶŵĞŶ...

AI summary The text presents a table with various columns related to infrastructure development, including system development, purpose, height, length, foundation structures, and costs. It includes details on removal costs, foundation structures, and other technical specifications for infrastructure projects.

7RWDO (TXLYOHQWQXPEHURI &UHVW ,QIDVWUXFWXUH džƉŽƐĞĚ dŽƚĂů 6\VWHP 'HYHORSPHQW ŽƌĞDĂƚĞƌŝĂů 3XUSRVH +HLJKW >ĞŶŐƚŚ 7RSRI &UHVW /HQJWK )RXQGDWLRQ VWUXFWXUHV EHQFKPDUNLQJ  džƉŽƐĞĚĂƌĞĂ ^ŝƚĞZĞƐƚŽƌĂƚŝŽŶ ŶǀŝƌŽŶŵĞŶƚĂů ŶǀŝƌŽŶŵĞŶ...

AI summary The text contains a table with various columns related to infrastructure development, including system development, purpose, height, length, elevation, and costs. It appears to be a technical document discussing infrastructure metrics and costs associated with a project.

7RWDO (TXLYOHQWQXPEHURI &UHVW ,QIDVWUXFWXUH džƉŽƐĞĚ dŽƚĂů 6\VWHP 'HYHORSPHQW ŽƌĞDĂƚĞƌŝĂů 3XUSRVH +HLJKW >ĞŶŐƚŚ 7RSRI &UHVW /HQJWK )RXQGDWLRQ VWUXFWXUHV EHQFKPDUNLQJ  džƉŽƐĞĚĂƌĞĂ ^ŝƚĞZĞƐƚŽƌĂƚŝŽŶ ŶǀŝƌŽŶŵĞŶƚĂů ŶǀŝƌŽŶŵĞŶ...

AI summary The text presents a table with columns such as 'System Development', 'Purpose', 'Height', 'Length', 'Foundation Structures Benchmarking', and 'Removal Cost'. It includes various technical terms and measurements related to infrastructure development and benchmarking.

7RWDO (TXLYOHQWQXPEHURI &UHVW ,QIDVWUXFWXUH džƉŽƐĞĚ dŽƚĂů 6\VWHP 'HYHORSPHQW ŽƌĞDĂƚĞƌŝĂů 3XUSRVH +HLJKW >ĞŶŐƚŚ 7RSRI &UHVW /HQJWK )RXQGDWLRQ VWUXFWXUHV EHQFKPDUNLQJ  džƉŽƐĞĚĂƌĞĂ ^ŝƚĞZĞƐƚŽƌĂƚŝŽŶ ŶǀŝƌŽŶŵĞŶƚĂů ŶǀŝƌŽŶŵĞŶ...

AI summary The text contains a table with columns related to infrastructure development, including system development, purpose, height, elevation, length, foundation structures, removal costs, and other technical details. The content appears to be related to infrastructure planning and development.

Ă ϭ͕ϲϬϵ Ϯϭ͘ϳ ϭ͕Ϯϭϱ Ϯ ϭϳ͕ϭϱϰ͕ϲϯϯ Ϯϳ͕ϯϱϯ ϭϬϮ Ϯ͕ϯϲϳ͕ϯϱϱ ϯ͕ϱϮϬ͕ϬϬϬ Ϯϯ͕Ϭϰϭ͕ϵϴϵ tZ <Ks ͲϲͲϮ 'ůĂĐŝĂůdŝůů ^ƚŽƌĂŐĞ ϭϬ ϭ͕ϮϬϬ ϭ͕Ϯϴϳ ϭ͕Ϯϴϲ ŶͬĂ ϭ͕ϮϬϬ ϯ͘Ϭ ϭ͕Ϯϳϳ ϭ ϯϯϳ͕Ϯϲϯ Ϯϳ͕ϯϱϯ ϭϰ ϯϮϴ͕ϳϵϵ ŝŶĐůƵĚĞĚĂďŽǀĞ ϲϲϲ͕ϬϲϮ REDACTED (CONFIDENTIAL INFORMATION R...

AI summary The text contains a table with numerical data and some redacted information. It includes a reference to a Hydro Asset Study Appendix B and a date of August 24, 2018. The content appears to be related to infrastructure planning and asset management.

7RWDO (TXLYOHQWQXPEHURI &UHVW ,QIDVWUXFWXUH džƉŽƐĞĚ dŽƚĂů 6\VWHP 'HYHORSPHQW ŽƌĞDĂƚĞƌŝĂů 3XUSRVH +HLJKW >ĞŶŐƚŚ 7RSRI &UHVW /HQJWK )RXQGDWLRQ VWUXFWXUHV EHQFKPDUNLQJ  džƉŽƐĞĚĂƌĞĂ ^ŝƚĞZĞƐƚŽƌĂƚŝŽŶ ŶǀŝƌŽŶŵĞŶƚĂů ŶǀŝƌŽŶŵĞŶ...

AI summary The text appears to be a table or part of a document containing technical details related to infrastructure development, including system development, infrastructure elevation, length, and foundation structures. It also includes terms such as 'benchmarking' and 'removal cost'.

cument will review environmental components, the scoring criteria, environmental division score and cost estimates from the Dam Decommissioning Cost Database. B.2 Environmental Components and Scoring Criteria The dams were categorized into...

AI summary The text discusses the categorization of dams into small, medium, and large based on size and environmental factors, including fisheries, stakeholder interest, and contaminated sediments, which are considered in environmental cost assessments.

ĚƵĂů ŚLJĚƌŽͲĞůĞĐƚƌŝĐ ŐĞŶĞƌĂƚŝŽŶ ƐLJƐƚĞŵ ĚĞƐĐƌŝƉƚŝŽŶƐ͕ ƉŽǁĞƌŚŽƵƐĞ ĚĞŵŽůŝƚŝŽŶ ƉůĂŶ ĚĞƐĐƌŝƉƚŝŽŶƐ ĂŶĚ ĂƐƐŽĐŝĂƚĞĚ ƐƉƌĞĂĚƐŚĞĞƚƐ ĞůƐĞǁŚĞƌĞ ŝŶ ƚŚŝƐ ƌĞƉŽƌƚ ĨŽƌ ŵŽƌĞ ĚĞƚĂŝůĞĚ ŝŶĨŽƌŵĂƚŝŽŶ͘     ǀ     REDACTED (CONFIDENTIAL I...

AI summary The text discusses the evaluation of a hydro asset study, including appendices and appendices related to the analysis of energy resources and infrastructure planning. It involves technical assessments and regulatory considerations.

   ϭ     REDACTED (CONFIDENTIAL INFORMATION REMOVED) REDACTED Hydro Asset Study Appendix C Page 8 of 143  EKs^Kd/WKt Z/E͘Ͳ,zZKWZKhd/KE ^/d  KDD/^^/KE/E' ^d/Dd ^hDDZz&KZ^^ dZ d/Z D EdK>/'d/KE^;ZKͿ^dh...

AI summary The text discusses the assessment of hydro assets, focusing on the evaluation of 31 assets and their impact on the utility's operations and financial planning. It highlights challenges related to asset management, cost recovery, and the implications of infrastructure planning for the utility's overall strategy.

   ϱ     REDACTED (CONFIDENTIAL INFORMATION REMOVED) REDACTED Hydro Asset Study Appendix C Page 12 of 143  EKs^Kd/WKt Z/E͘Ͳ,zZKWZKhd/KE ^/d  KDD/^^/KE/E' ^d/Dd ^hDDZz&KZ^^ dZ d/Z D EdK>/'d/KE^;ZKͿ^dh...

AI summary The document discusses the historical context and evolution of the Nova Scotia Power Inc. (NSPI) hydro asset study, focusing on the analysis of energy generation and management from 1920 to 1980. It outlines the challenges faced in managing energy resources and the implications for future planning.

Ě ĂŶĚ ƌĞŵŽǀĞĚ ďLJ ŽƚŚĞƌƐ͕ ƚŚĂƚ Ăůů ĞůĞĐƚƌŝĐĂů ĂŶĚ ĐŽŵŵƵŶŝĐĂƚŝŽŶƐ ĞƋƵŝƉŵĞŶƚ ĚŝƌĞĐƚůLJ ƌĞůĂƚĞĚƚŽƚƌĂŶƐŵŝƐƐŝŽŶǁŝůůďĞƌĞŵŽǀĞĚďLJŽƚŚĞƌƐĂŶĚƚŚĂƚƚŚĞƌĞĂƌĞŶŽŽƵƚƐƚĂŶĚŝŶŐĂƐďĞƐƚŽƐ    ϭϲ     REDACTED (CONFIDENTIAL INFORMATI...

AI summary The text discusses a confidential hydro asset study appendix, focusing on the evaluation of hydroelectric assets and their implications for energy generation and management. It includes technical details and analysis related to the assets, though specific content is redacted.

ŵŝƐƐŝŽŶŝŶŐĞdžĞƌĐŝƐĞŝŶĐůƵĚĞďƵŝůĚŝŶŐĚĞŵŽůŝƚŝŽŶ ĂŶĚƌĞůĂƚĞĚŵĂƚĞƌŝĂůƐĚŝƐƉŽƐĂů͕ĂŶĚƐŝƚĞƉƌŽƚĞĐƚŝŽŶĂŶĚƌĞŵĞĚŝĂƚŝŽŶƉŽƐƚĚĞŵŽůŝƚŝŽŶ͘      ϭϴ     REDACTED (CONFIDENTIAL INFORMATION REMOVED) REDACTED Hydro Asset Study Appendix C...

AI summary The text contains redacted information from a Hydro Asset Study Appendix, indicating that confidential details have been removed. It references a study related to asset management and possibly infrastructure planning, but the content is not fully visible due to redaction.

   REDACTED (CONFIDENTIAL INFORMATION REMOVED) REDACTED Hydro Asset Study Appendix C Page 27 of 143  EKs^Kd/WKt Z/E͘Ͳ,zZKWZKhd/KE ^/d  KDD/^^/KE/E' ^d/Dd ^hDDZz&KZ^^ dZ d/Z D EdK>/'d/KE^;ZKͿ^dhz;LJ^LJƐƚ...

AI summary The text discusses challenges in managing hydro assets, including issues with asset performance, maintenance strategies, and the impact of operational decisions on long-term sustainability and efficiency. It highlights concerns related to aging infrastructure, maintenance planning, and the need for comprehensive studies to support informed decision-making.

rtial removal of sub-structure; infilling of the powerhouse and an estimate of off-site disposal costs.

AI summary The text discusses the partial removal of sub-structure, infilling of the powerhouse, and an estimate of off-site disposal costs.

alls, removal of sub-structure; infilling of the powerhosue and an estimate of off-site disposal costs.

AI summary The text mentions the removal of sub-structure, infilling of the powerhouse, and an estimate of off-site disposal costs. These activities are likely related to infrastructure planning or asset management.

-$500.00 Allowance General Parts -$1,000.00 Allowance Insulated Wire and Cables No. 1 -$1,000.00 Allowance Insulated Wire and Cables No. 2 -$1,000.00 Allowance ENGINEERING & PROJECT MANAGEMENT Engineering & Project Management $84,339.00 Si...

AI summary The text outlines various allowances and costs associated with a site decommissioning estimate, including allowances for general parts, insulated wire and cables, and engineering and project management expenses, with a subtotal for the Avon No. 2 Development and additional notes on HST.

   Ϯϰ     REDACTED (CONFIDENTIAL INFORMATION REMOVED) REDACTED Hydro Asset Study Appendix C Page 31 of 143  EKs^Kd/WKt Z/E͘Ͳ,zZKWZKhd/KE ^/d  KDD/^^/KE/E' ^d/Dd ^hDDZz&KZ^^ dZ d/Z D EdK>/'d/KE^;ZKͿ^d...

AI summary This document discusses the evaluation of hydro asset studies, including considerations for asset management, infrastructure planning, and energy efficiency. It highlights the importance of managing hydro assets, ensuring proper infrastructure planning, and implementing energy efficiency measures. The study also touches on the challenges of maintaining and upgrading hydro facilities.

Ő ƚŚĞ ŽŶͲƐŝƚĞ ƐĞǁĂŐĞ ĚŝƐƉŽƐĂů ƐLJƐƚĞŵ͕ ƐĂŶŝƚĂƌLJ ƉƵŵƉƐ ĂŶĚ ƉŝƉŝŶŐ͕ ĂŶLJ ĨƌĞƐŚǁĂƚĞƌƉŝƉŝŶŐĂŶĚĞƋƵŝƉŵĞŶƚ͘ x ŝƐƉŽƐĂůŽĨĐŽŶƐƚƌƵĐƚŝŽŶĂŶĚĚĞŵŽůŝƚŝŽŶĚĞďƌŝƐʹƚƌƵĐŬƐĞůĞĐƚĞĚŵĂƚĞƌŝĂůƐƚŽĂĚĞƐŝŐŶĂƚĞĚĐŽŶƐƚƌƵĐƚŝŽŶ ĚĞďƌŝƐ ĚŝƐƉŽƐĂů...

AI summary The text discusses the challenges in managing fuel costs and the implications of delayed rate adjustments, highlighting the need for better alignment between base rates and actual costs. It also mentions the importance of asset management, infrastructure planning, and the impact of these factors on energy efficiency and customer affordability.

   Ϯϲ     REDACTED (CONFIDENTIAL INFORMATION REMOVED) REDACTED Hydro Asset Study Appendix C Page 33 of 143  EKs^Kd/WKt Z/E͘Ͳ,zZKWZKhd/KE ^/d  KDD/^^/KE/E' ^d/Dd ^hDDZz&KZ^^ dZ d/Z D EdK>/'d/KE^;ZKͿ^d...

AI summary The document discusses the evaluation of hydro asset studies, focusing on issues such as energy efficiency, infrastructure planning, and regulatory compliance. Key topics include the analysis of asset management, generation and grid resources, and the impact of various programs and customer initiatives on the energy sector.

ŶŐ͘ dŚĞƌĞŝƐĂŵƉůĞŵĂƚĞƌŝĂůůĂLJĚŽǁŶĂƌĞĂĂƚƐŝƚĞ͘ dŚĞƌĞŝƐĂŵƉůĞƌŽŽŵĂƚƚŚŝƐƐŝƚĞƚŽďƵƌLJƐƵŝƚĂďůĞĐŽŶĐƌĞƚĞĚĞďƌŝƐ͕ĚĞǀŽŝĚŽĨƌĞďĂƌ͕ĂŶĚĞŵďĞĚĚĞĚ ŵĞƚĂůƐ͘     ϯϭ     REDACTED (CONFIDENTIAL INFORMATION REMOVED) REDACTED Hydro A...

AI summary The text discusses the evaluation of hydro asset studies, including the assessment of asset retirement obligations, the impact of aging infrastructure, and the need for investment in maintenance and upgrades. It outlines key considerations for managing hydroelectric assets and their long-term sustainability.

   ϯϲ     REDACTED (CONFIDENTIAL INFORMATION REMOVED) REDACTED Hydro Asset Study Appendix C Page 43 of 143  EKs^Kd/WKt Z/E͘Ͳ,zZKWZKhd/KE ^/d  KDD/^^/KE/E' ^d/Dd ^hDDZz&KZ^^ dZ d/Z D EdK>/'d/KE^;ZKͿ^d...

AI summary The text discusses the evaluation of a hydro asset study, focusing on asset retirement obligations, the impact of energy efficiency programs, and the financial and operational considerations of utility companies. It highlights challenges related to infrastructure planning, cost recovery, and regulatory compliance.

x /ŶƚĂŬĞůĂƐƐŝĨŝĐĂƚŝŽŶͲĂƚĞŐŽƌLJ͕ƚǁŝŶĞdžƉŽƐĞĚĂďŽǀĞŐƌŽƵŶĚƉĞŶƐƚŽĐŬƐ͖ x ƌĐŚŝƚĞĐƚƵƌĂůůĂƐƐŝĨŝĐĂƚŝŽŶʹĂƚĞŐŽƌLJ͕ƌĞŝŶĨŽƌĐĞĚĐŽŶĐƌĞƚĞ͕ƐƚĞĞůĂŶĚŵĂƐŽŶƌLJ͖    ϯϴ     REDACTED (CONFIDENTIAL INFORMATION REMOVED) REDACTED Hydr...

AI summary The document discusses the evaluation of hydro assets, including the analysis of energy generation, infrastructure planning, and grid management. It highlights the importance of asset management, system reliability, and the integration of renewable energy resources.

   ϰϬ     REDACTED (CONFIDENTIAL INFORMATION REMOVED) REDACTED Hydro Asset Study Appendix C Page 47 of 143  EKs^Kd/WKt Z/E͘Ͳ,zZKWZKhd/KE ^/d  KDD/^^/KE/E' ^d/Dd ^hDDZz&KZ^^ dZ d/Z D EdK>/'d/KE^;ZKͿ^d...

AI summary This document discusses a hydro asset study, focusing on the historical context of a hydroelectric project initiated in 1952. It outlines the challenges faced during the project's implementation, including the use of a 3.2 Dt system and the involvement of various stakeholders. The study highlights the importance of infrastructure planning and the integration of energy resources.

   ϰϭ     REDACTED (CONFIDENTIAL INFORMATION REMOVED) REDACTED Hydro Asset Study Appendix C Page 48 of 143  EKs^Kd/WKt Z/E͘Ͳ,zZKWZKhd/KE ^/d  KDD/^^/KE/E' ^d/Dd ^hDDZz&KZ^^ dZ d/Z D EdK>/'d/KE^;ZKͿ^d...

AI summary The document discusses the evaluation of a hydro asset study, including considerations related to asset management, energy efficiency, and infrastructure planning. It outlines various factors such as cost recovery, fuel adjustment mechanisms, and the integration of renewable resources into the grid. The analysis includes technical assessments and planning for future energy needs.

rtial removal of sub-structure; infilling of the powerhouse and an estimate of off-site disposal costs.

AI summary The text discusses the partial removal of sub-structure, infilling of the powerhouse, and an estimate of off-site disposal costs, likely related to infrastructure planning or asset management.

/E' ^d/Dd ^hDDZz&KZ^^ dZ d/Z D EdK>/'d/KE^;ZKͿ^dhz;LJ^LJƐƚĞŵͿ   x WůĂĐĞ ƚŽƉƐŽŝů͕ ƐŽĚƐͬŚLJĚƌŽͲƐĞĞĚ͕ ŵŝƐĐĞůůĂŶĞŽƵƐ ƌƵĚŝŵĞŶƚĂƌLJ ůĂŶĚƐĐĂƉŝŶŐ ĂƐ ŵĂLJ ďĞ ƌĞƋƵŝƌĞĚ ĨŽƌ ƉƵďůŝĐ ƐĂĨĞƚLJĂŶĚƚŽĨĂĐŝůŝƚĂƚĞƐƵƌĨĂĐĞĚƌĂŝŶĂŐĞ...

AI summary The text discusses the implementation of fuel-cost-adjustment mechanisms and their impact on rate structures, as well as the evaluation of asset management and infrastructure planning in the context of a regulatory proceeding. It highlights concerns around cost recovery and the need for accurate forecasting and prudence reviews.

rtial removal of sub-structure; infilling of the powerhouse and an estimate of off-site disposal costs.

AI summary The text references the partial removal of sub-structure, infilling of the powerhouse, and an estimate of off-site disposal costs. These activities are likely related to infrastructure planning or asset management.

ƐƵďƐƚƌƵĐƚƵƌĞ͘^ƚŽĐŬƉŝůĞĚĞďƌŝƐĨŽƌĚŝƐƉŽƐĂů͘ x ZĞŵŽǀĞ ďƵƌŝĞĚ ƐĞƌǀŝĐĞƐ ŝŶĐůƵĚŝŶŐ ƚŚĞ ŽŶͲƐŝƚĞ ƐĞǁĂŐĞ ĚŝƐƉŽƐĂů ƐLJƐƚĞŵ͕ ƐĂŶŝƚĂƌLJ ƉƵŵƉƐ ĂŶĚ ƉŝƉŝŶŐ͕ ĂŶLJ ĨƌĞƐŚǁĂƚĞƌƉŝƉŝŶŐĂŶĚĞƋƵŝƉŵĞŶƚ͘    ϲϲ     REDACTED (CONFIDENTIAL I...

AI summary The text discusses the challenges in managing energy resources, particularly focusing on the evaluation of hydro assets and their impact on the energy system. It highlights the need for careful planning and consideration of various factors in energy generation and distribution.

rtial removal of sub-structure; infilling of the powerhouse and an estimate of off-site disposal costs.

AI summary The text mentions the partial removal of sub-structure, infilling of the powerhouse, and an estimate of off-site disposal costs, indicating infrastructure-related activities.

rtial removal of sub-structure; infilling of the powerhouse and an estimate of off-site disposal costs.

AI summary The text mentions the partial removal of sub-structure, infilling of the powerhouse, and an estimate of off-site disposal costs. These are infrastructure-related activities.

Ŷ ǁŝƚŚ ĐŽŵƉĂĐƚĞĚ ŐƌĂŶƵůĂƌ ŵĂƚĞƌŝĂů ĂŶĚ ƐĞůĞĐƚĞĚ ĚĞŵŽůŝƚŝŽŶ ĚĞďƌŝƐƚŽƚŚĞƚĂŝůƌĂĐĞĐŽĨĨĞƌĚĂŵ͘dŚĞĐŽĨĨĞƌĚĂŵĐĂŶƌĞŵĂŝŶŽŶĐĞŐƌĂĚĞĚƚŽŵĂƚĐŚƐŝƚĞ͘WƌŽǀŝĚĞĞƌŽƐŝŽŶ ƉƌŽƚĞĐƚŝŽŶĂƐƌĞƋƵŝƌĞĚ͘    ϵϬ     REDACTED (CONFIDENTIAL INF...

AI summary The text discusses the challenges in managing and maintaining hydro assets, including the need for regular maintenance, cost considerations, and the impact of environmental factors on asset performance. It highlights the importance of efficient resource allocation and the potential consequences of neglecting maintenance.

ŝƐƐŝŽŶŝŶŐĞdžĞƌĐŝƐĞŝŶĐůƵĚĞďƵŝůĚŝŶŐĚĞŵŽůŝƚŝŽŶĂŶĚ ƌĞůĂƚĞĚŵĂƚĞƌŝĂůƐĚŝƐƉŽƐĂů͕ĂŶĚƐŝƚĞƉƌŽƚĞĐƚŝŽŶĂŶĚƌĞŵĞĚŝĂƚŝŽŶƉŽƐƚĚĞŵŽůŝƚŝŽŶ͘      ϵϱ     REDACTED (CONFIDENTIAL INFORMATION REMOVED) REDACTED Hydro Asset Study Appendix C P...

AI summary The text contains redacted information from a Hydro Asset Study Appendix, which discusses various aspects of asset management and infrastructure planning. It includes details related to the evaluation of hydroelectric assets and their impact on energy generation and grid reliability.

ŚŚLJĚƌŽƉƌŽĚƵĐƚŝŽŶ ĂĐƚŝǀŝƚŝĞƐ͘ x ŝƐƉŽƐĂůŽĨĐŽŶƐƚƌƵĐƚŝŽŶĂŶĚĚĞŵŽůŝƚŝŽŶĚĞďƌŝƐʹƚƌƵĐŬƚŽĂĚĞƐŝŐŶĂƚĞĚĐŽŶƐƚƌƵĐƚŝŽŶĚĞďƌŝƐĚŝƐƉŽƐĂůĨĂĐŝůŝƚLJ͘ x ĞůŝǀĞƌŽƌƐĞůůƐƚŽĐŬƉŝůĞĚƐĂůǀĂŐĞŵĂƚĞƌŝĂů͘    ϵϳ     REDACTED (CONFIDENTIAL IN...

AI summary The document discusses the evaluation of a hydro asset study, including considerations related to the management and assessment of hydroelectric resources. It outlines the need for detailed analysis and evaluation of hydro assets as part of broader regulatory and planning processes.

rtial removal of sub-structure; infilling of the powerhouse and an estimate of off-site disposal costs.

AI summary The text mentions partial removal of sub-structure, infilling of the powerhouse, and an estimate of off-site disposal costs, likely related to infrastructure or construction activities.

ĂůůLJƉůĂĐĞĚƚŽƉƌŽǀŝĚĞĂƐƐŝƐƚĂŶĐĞĨŽƌƚƵƌďŽͲŐĞŶĞƌĂƚŽƌŽƉĞƌĂƚŝŽŶ͘ x /ŶƐƚĂůůĂƚŝŽŶ ŽĨ Ă ŐƌĂŶƵůĂƌ ĂŶĚ ƌĞůĂƚŝǀĞůLJ ǁĂƚĞƌͲƚŝŐŚƚ ĞĂƌƚŚͲĨŝůů ĐŽĨĨĞƌĚĂŵ Ăƚ ƚŚĞ ĚƌĂĨƚͲƚƵďĞ ŽƵƚůĞƚ ĂŶĚ ƚĂŝůƌĂĐĞ͘    ϭϭϮ     REDACTED (CONFIDENTIAL...

AI summary The text discusses the analysis of a regulatory proceeding in Nova Scotia, including a redacted hydro asset study. It outlines the need for a comprehensive evaluation of asset retirement obligations and financial mechanisms related to energy efficiency and infrastructure planning.

ĐƚƵƌĞĂŶĚƌĞůĂƚĞĚŵŝƐĐĞůůĂŶĞŽƵƐƉĂƌƚƐĂŶĚĐŽŵƉŽŶĞŶƚƐ͘^Ğƚ ĂƐŝĚĞ͕ƐƚŽĐŬƉŝůĞĨŽƌƐĂůǀĂŐĞĂŶĚĚŝƐƉŽƐĂů͘ x ZĞŵŽǀĞŽǀĞƌŚĞĂĚƌŝĚŐĞƌĂŶĞĂŶĚƐƚŽĐŬƉŝůĞĚƚƵƌďŽͲŐĞŶĞƌĂƚŽƌŵĂŝŶĐŽŵƉŽŶĞŶƚƐ͕ƐŽƌƚĂŶĚƐƚŽĐŬƉŝůĞĂƚ ƐŝƚĞĨŽƌƐĂůǀĂŐĞĂŶĚĚŝƐƉŽƐĂů͘ ...

AI summary The text discusses the analysis of a regulatory proceeding document, focusing on the evaluation of a hydro asset study. It includes redacted information and mentions the need for confidentiality. The document appears to be part of a larger proceeding involving technical and financial assessments.

Remove asphalt and re-grade selected access roads and Site Access Removals $85,000.00 parking area(s). Remove site sewage disposal system and domestic water Site Services Removals $20,000.00 supply system at this location. BUILDINGS & STRU...

AI summary The text outlines various removal and regrading activities related to site access roads, site services, and buildings and structures, with associated costs. These include removing asphalt, regrading roads, removing sewage and water systems, and demolishing auxiliary buildings.

$2,052,027.20 Notes: 1. Transmission cable, substations and related transformers to be removed by others in preparation for general demolition. 2. HST is additional to stated estimated costs. Figure 31 REDACTED (CONFIDENTIAL INFORMATION RE...

AI summary The text discusses the removal of transmission infrastructure and the inclusion of HST in estimated costs. It also mentions the EKS Hydro Asset Study and related technical details regarding asset management and infrastructure planning.

$YRQ5LYHU+\GUR6\VWHP $YRQ1R'HYHORSPHQW    $YRQ1R'HYHORSPHQW   %HDU5LYHU+\GUR6\VWHP 5LGJH'HYHORSPHQW  XOFK'...

AI summary The text provides a list of development costs for various river hydro systems, including specific project names and associated financial figures. These figures detail the costs for different components of the hydro systems, such as Bear River, Black River, and others.

Dƌ͘zĂƚĞƐŐƌĂĚƵĂƚĞĚĨƌŽŵdĞĐŚŶŝĐĂůhŶŝǀĞƌƐŝƚLJŽĨEŽǀĂ^ĐŽƚŝĂ;EŽǀĂ^ĐŽƚŝĂdĞĐŚŶŝĐĂůŽůůĞŐĞͿŝŶϭϵϴϭ͕ ǁŝƚŚĂĂĐŚĞůŽƌ ŶŐŝŶĞĞƌŝŶŐ;ŝǀŝůͿ͘Dƌ͘zĂƚĞƐƌĞĐĞŝǀĞĚWƌŽĨĞƐƐŝŽŶĂů ŶŐŝŶĞĞƌƐƚĂƚƵƐŝŶϭϵϴϯ͘    ϭϯϯ     REDACTED (CONFIDENTI...

AI summary The text references a historical document related to a regulatory proceeding in Nova Scotia, including a redacted hydro asset study and a senior structural/civil engineer named James B. Yates. It discusses a study related to asset management and infrastructure planning.

REDACTED Hydro Asset Study Appendix C Page 141 of 143 $33(1',;&9 JAMES B. YATES, P.ENG. SENIOR STRUCTURAL/CIVIL ENGINEER Education: Bachelor of Engineering, Civil, Technical University of Nova Scotia, 1981 Professional Associations:...

AI summary The document provides a detailed professional profile of James B. Yates, a senior structural and civil engineer with over thirty years of experience in various engineering projects across Nova Scotia, including hydroelectric facilities, marine infrastructure, and building structures.

work and upgrading of marine fuel offloading facility for Nova Scotia Power Inc.’s 350 MW Tuft’s Cove thermal generation station. x Design of a structural base and installation of a 500-tonne press for HMC Dockyard’s Ship Repair Unit. x As...

AI summary The text outlines various engineering and construction projects undertaken by Nova Scotia Power Inc. and other organizations, including upgrades to marine fuel offloading facilities, structural designs for ship repair units, assessments of industrial infrastructure, and engineering for military and maritime facilities.

Nova Scotia. x Design and construction supervision for repairs and improvements (and new construction) for dozens of fish passage and related infrastructure located in Nova Scotia. Marine and Offshore Facilities: x Site investigations and...

AI summary The text outlines various infrastructure projects related to fish passage and marine facilities in Nova Scotia and the West Indies, including design, construction supervision, and assessments. It also mentions a redacted hydro asset study and a senior structural/civil engineer named James B. Yates.

t Letter” motion picture in Shelburne, Nova Scotia. x Structural and mechanical engineering support for sets and props associated with “The Sea Wolf” motion picture, filmed in Halifax. Other Civil Projects: x Seven kilometres of Trans-Cana...

AI summary The document outlines various engineering and construction projects undertaken in Nova Scotia, including support for film productions, highway and roadway rehabilitation, municipal infrastructure, and a study related to the demolition of the Annapolis Tidal Power Generation Station powerhouse.

R INC. ‐ HYDRO PRODUCTION ANNAPOLIS TIDAL POWER GENERATION STATION POWERHOUSE DEMOLITION STUDY

AI summary The document discusses the demolition study for the powerhouse at the Annapolis Tidal Power Generation Station, likely involving considerations related to infrastructure planning and generation resources.

DISCLAIMER This report is prepared for Nova Scotia Power Inc. (the “Client”) by J.B. Yates Engineering Limited (the “Consultant”) and is subject to the following limitations, qualifications and disclaimers: 1.) This report is prepared sole...

AI summary This disclaimer outlines the limitations and disclaimers of a report prepared by J.B. Yates Engineering Limited for Nova Scotia Power Inc. regarding the Annapolis Tidal Power Generation Station – Powerhouse Demolition Study. It emphasizes that the report is for the exclusive use of the Client and highlights the risks and uncertainties inherent in the project.

2. Facility Description and Conceptual Demolition Methodology General overall demolition methodology will involve various steps in establishing site security, worker safety and environmental protection during the dismantling, demolition, i...

AI summary The document outlines the facility description and conceptual demolition methodology for a site, emphasizing site security, worker safety, and environmental protection. It discusses the challenges of de-watering due to tidal ranges and the use of steel stop logs as a recommended solution. The causeway's continued use during demolition is also addressed.

is utilized in order to protect agricultural land from seawater inundation and to minimize the potential for flooding in the town. Powerhouse reinforced concrete turbine floor (basement floor level) is set below the elevation of the Annapo...

AI summary The text describes the structural components and design features of a powerhouse, including reinforced concrete elements, turbine housing, access platforms, HVAC systems, and lift devices. These features are designed to ensure operational efficiency, safety, and facilitate maintenance and decommissioning activities.

of experience in structural, heavy civil and multi‐disciplinary engineering projects encompassing concept development, design, construction planning and supervision, and investigations and reporting. Those projects have involved new constr...

AI summary The text outlines the professional experience of Mr. Yates in civil and structural engineering, focusing on infrastructure projects such as hydro-electric facilities, bridges, and marine structures. His work includes projects for Nova Scotia Power and other organizations, emphasizing his involvement in assessments, maintenance, and improvements for energy and transportation infrastructure.

for Nalcor in Newfoundland and Labrador. Work has been carried out on similar infrastructure for Halifax Water, NSBI and the Nova Scotia Department of Transportation and Infrastructure Renewal (TIR). In marine areas, Mr. Yates has been lea...

AI summary The text discusses the professional background of Mr. Yates, highlighting his extensive experience in marine infrastructure engineering, including projects for NSBI, Halifax Port Corporation, and others. It also mentions his education and career with engineering consulting firms in Nova Scotia.

Industrial and Power Projects:  For Nova Scotia Power Inc.: Engineering design, evaluation, construction cost estimates derivation and construction management for implementation of improvements and repairs to hydroelectric assets includin...

AI summary The text outlines various engineering and infrastructure projects related to hydroelectric assets managed by Nova Scotia Power Inc. and other entities, including design, construction, and remediation efforts for dams, pipelines, and related infrastructure.

 Design of replacement pipeline and penstock for Berwick Electric’s hydroelectric generating station.  Design of remediations and repairs to Middle River dam and sluiceway for the Nova Scotia Department of Transportation and Infrastructu...

AI summary The text outlines various engineering projects and services provided by different organizations, including the design and maintenance of infrastructure for hydroelectric and thermal generation stations, as well as remediation and repair work for dams and related structures across Nova Scotia and Newfoundland and Labrador.

work and upgrading of marine fuel offloading facility for Nova Scotia Power Inc.’s 350 MW Tuft’s Cove thermal generation station.  Design of a structural base and installation of a 500-tonne press for HMC Dockyard’s Ship Repair Unit.  As...

AI summary The text outlines various engineering and design projects undertaken by Nova Scotia Power Inc. and other entities, including upgrades to marine fuel offloading facilities, structural assessments, and infrastructure improvements across Nova Scotia.

Nova Scotia.  Design and construction supervision for repairs and improvements (and new construction) for dozens of fish passage and related infrastructure located in Nova Scotia. Marine and Offshore Facilities:  Site investigations and...

AI summary The document outlines various infrastructure projects, including fish passage improvements, marine and offshore facility design, and waterfront development across multiple locations in Nova Scotia and the West Indies. It includes details on site investigations, engineering support, and infrastructure assessments.

Building Projects:  Design for piled foundations and steel superstructure for Metal fabrication plant for Woodside Fabricators Ltd.  Structural evaluations for various buildings on Saint Mary’s University Campus, and design of required r...

AI summary The text lists various building projects undertaken, including structural evaluations, design work for industrial and residential buildings, and engineering support for film production sets. These projects span multiple locations in Nova Scotia and involve different organizations and institutions.

commissioned, and all infrastructure (dams, dykes, powerhouses, etc.) were removed, and water levels were returned to historic levels. The following is a list of the hydro-systems that were evaluated: • The Avon River hydro-system; • The B...

AI summary The document discusses the decommissioning of various hydro-systems in Nova Scotia, including the Avon River, Bear River, Black River, and others, and the potential environmental impacts on wetlands due to changes in water management regimes.

urveying Environmental Bedford Antigonish Moncton Deer Lake Date: Project #: July 2018 18-6450 Scale: Map Index: 1:30,000 0 ¯ 1 2 3 Drawn By: M. Marriott Checked By: 8 Kilometres S. Dickey REDACTED (CONFIDENTIAL INFORMATION REMOVED) Hydro...

AI summary The document contains a redacted section from a Hydro Asset Study Appendix E, which includes a map and project details from July 2018. It appears to be related to environmental surveying and infrastructure planning in Nova Scotia.

NSTD, GeoNOVA, Geogratis. 2. Projection: NAD83 UTM Zone 20N

AI summary The text lists organizations and a projection system used in mapping, indicating involvement in geographic data and infrastructure planning.

tal Bedford Antigonish Moncton Deer Lake Date: Project #: July 2018 18-6450 Scale: Map Index: 1:30,000

AI summary The text presents a map with locations including Bedford, Antigonish, Moncton, and Deer Lake, dated July 2018, with project number 18-6450, scale 1:30,000, and a map index. It appears to be a geographical or infrastructure planning document.

23 Little Tupper Marsh Lake 0 5 10 15 20 Salt Marsh Kilometres Swamp Water Transportation Road Network Water Features Mapped Stream Mapped Indefinite Stream Mapped Lakes and Rivers

AI summary The text presents a map of Little Tupper Marsh, Lake, and surrounding areas, including transportation routes, water features, and road networks. It includes geographical elements such as mapped streams, lakes, rivers, and swamp areas.

Fen 23 Marsh 0 5 10 15 20 Salt Marsh Kilometres Swamp Elizabeth Lake Water Transportation Road Network Water Features Mapped Stream Mapped Indefinite Stream Mapped Lakes and Rivers

AI summary The text appears to be a map or geographic representation depicting features such as marshes, lakes, roads, and waterways in a specific area, likely related to infrastructure planning or environmental assessment.

Bog or Fen 21 Fen 23 Marsh 0 5 10 15 20 Salt Marsh Kilometres Swamp Water Transportation Road Network Water Features Mapped Stream Mapped Indefinite Stream Mapped Lakes and Rivers

AI summary The text appears to be a map or diagram depicting various geographical features such as bogs, fens, marshes, swamps, water bodies, and transportation infrastructure, including road networks and mapped streams, lakes, and rivers.

Mersey Lake Hydro System Toney Lake Engineering Surveying Environmental Bedford Antigonish Moncton Deer Lake Date: Project #: July 2018 18-6450 Scale: Map Index: 1:30,000

AI summary The text presents a map and project details related to a hydro system in Nova Scotia, including locations such as Mersey Lake and Toney Lake, with associated engineering, surveying, and environmental services provided by a company operating in Bedford, Antigonish, Moncton, and Deer Lake. The project date is July 2018, with project number 18-6450 and a scale of 1:30,000.

Marsh Salt Marsh Swamp Water Transportation Road Network Water Features Mapped Stream Mapped Indefinite Stream Mapped Lakes and Rivers

AI summary The text outlines various geographical and environmental features, including marshes, swamps, water bodies, transportation networks, and road systems, as well as mapped water features such as streams, lakes, and rivers.

Bedford Antigonish Moncton Deer Lake Pr Date: Project #: July 2018 18-6450 Scale: Map Index: 1:30,000

AI summary The text includes a map with locations such as Bedford, Antigonish, Moncton, and Deer Lake, dated July 2018, with project number 18-6450 and scale 1:30,000. It appears to be related to a geographical or infrastructure planning document.

Bedford Antigonish Moncton Deer Lake Date: Project #: July 2018 18-6450 Scale: Map Index: 1:30,000

AI summary The document contains a map index and scale information for a project located in Bedford, Antigonish, Moncton, and Deer Lake, with a project number of 18-6450 and a date of July 2018. The scale is 1:30,000.

Scale: Map Index: 1:30,000 0 ¯ 1 2 3 Drawn By: M. Marriott Checked By: 6 Kilometres S. Dickey REDACTED (CONFIDENTIAL INFORMATION REMOVED) Hydro Asset Study Appendix E Page 131 of 163 Notes: ¯ 1 2 3 1. Data Sources: NS Power Inc., NSTD, Geo...

AI summary This document contains a map index and scale for a hydro asset study, noting data sources such as NS Power Inc., NSTD, GeoNOVA, and Geogratis, and includes a projection reference (NAD83 UTM Zone 20N).

1:30,000 ¯ Tusket 10 Drawn By: M. Marriott 0 1 2 3 Checked By: Kilometres S. Dickey REDACTED (CONFIDENTIAL INFORMATION REMOVED) Hydro Asset Study Appendix E Page 141 of 163 Notes:

AI summary The text contains a redacted section of a Hydro Asset Study Appendix, which includes a map titled 'Tusket' with a scale and drawing information. The content appears to be related to infrastructure planning and asset management.

Bog or Fen 12 Fen 0 4 8 12 16 Marsh Salt Marsh Kilometres Ingonish II Swamp Reservoir Water Transportation Canal Road Network Water Features Mapped Stream Mapped Indefinite Stream Mapped Lakes and Rivers

AI summary The text presents a map depicting geographical features including bogs, fens, marshes, salt marshes, swamps, reservoirs, canals, road networks, and water features such as mapped streams, lakes, and rivers in the Ingonish II area.

.00 The Cove 0.80 REDACTED (CONFIDENTIAL INFORMATION REMOVED) Hydro Asset Study Appendix E Page 159 of 163 Table 1. Wetland Alteration Permitting Cost Estimates Project # 18-6450

AI summary The text provides a redacted section of a Hydro Asset Study Appendix E, which includes a table titled 'Wetland Alteration Permitting Cost Estimates' under Project #18-6450. The content is partially redacted, indicating that it contains confidential information.

Harmony Molega Lake 77.44 Medium Ponhook Lake 69.47 Whynott Lake 7.49 Lequille Allains Creek 98.90 255.70 Medium $ 7,500.00 Ten Mile River 52.42 Crotchet Lake 16.39 Dargie Lake 2.27 Grand Lake 65.54 Lambs Lake 20.18 Mersey Mersey River 25....

AI summary The text lists various lakes and rivers along with associated measurements and financial figures, potentially related to water management or resource planning, though the context is unclear.

REDACTED Hydro Asset Study Appendix F Page 24 of 146 NSPI – Hydro Asset Costing Document 3.4 BEAR RIVER HYDRO SYSTEM - COSTING The Bear River Hydro System is situated within Annapolis and Digby Counties, approximately 5 km southeast of the...

AI summary This section discusses the Bear River Hydro System, its location, components, and the potential costs associated with the removal of assets related to the Annapolis Hydro System. It notes that actual archaeological assessment costs may vary within the presented range.

t Study Appendix F Page 42 of 146 NSPI – Hydro Asset Costing Document It is estimated that the archaeological assessment can be undertaken at a cost between and plus applicable taxes. Asset Location: Aylesford Lake Type: Dewatering Based o...

AI summary The document discusses the estimated costs for an archaeological assessment at Aylesford Lake Reservoir, noting high potential for archaeological resources. It also provides details about the Dickie Brook Hydro System, including its location, capacity, and associated infrastructure.

ated that the archaeological assessment can be undertaken at a cost off plus p applicable taxes. Page 77 REDACTED (CONFIDENTIAL INFORMATION REMOVED) REDACTED Hydro Asset Study Appendix F Page 81 of 146 NSPI – Hydro Asset Costing Document 3...

AI summary The text discusses the Roseway Hydro System in Shelburne County, Nova Scotia, and outlines the potential costs associated with the removal of its assets, including the Roseway Dam, Saddle Dam, and Spillway. The costs include archaeological assessment, reconnaissance, shovel testing, and excavation.

ated that the archaeological assessment can be undertaken at a cost between andd plus applicable taxes. Asset Location: Gisborne Plant Type: Plant/Powerhouse Based on previous background research and archaeological potential modelling, the...

AI summary The document outlines archaeological assessments required for several hydroelectric assets in Nova Scotia, including the Gisborne Plant, D8-1-D8-7 and Wing Dams, and D9, D10. The assessments range from reconnaissance to excavation, with estimated costs provided for each location.

Bear River Bear River Powerhouse 67.88608281650 279.96754808500 Gulch Main Dam (Sam Harris Earthfill with concrete Bear River Dam) Medium core wall Yes 766.79897072500 12667.92828930000 Gulch Main Dam (Sam Harris Earthfill with concrete Be...

AI summary The text presents data related to Bear River Powerhouse and various dams and infrastructure components, including details on their construction materials, sizes, and capacities. However, the content is redacted, and confidential information has been removed.

545.94885185200 12972.57695920000 Black River White Rock Plant 272.78408985200 4601.55586586000 Dickie Brook Donahue Dam Small Earthfill embankment Yes 179.22071558000 1429.38300825000 Dickie Brook Pipeline 3094.49798829000 31145.686691400...

AI summary The text presents a list of infrastructure assets, including dams, pipelines, and spillways, along with their respective locations, sizes, types, and associated costs. It includes details such as the names of the facilities, their locations, and financial figures related to each asset.

Mersey Cowie Lake Falls Earthfill Dam Medium Earthfill 473.16642495800 3815.43515228000 Constructed on Mersey Cowie Lake Falls Sluiceway Medium bedrock 114.42547679200 624.77710419200 Constructed on Mersey Cowie Lake Falls Spillway Medium...

AI summary The text lists various dams and infrastructure components in the Mersey area, including their types, construction materials, and dimensions. It provides details on earthfill dams, spillways, sluiceways, and powerhouses, along with measurements and locations.

Mersey Lower Lake Falls Powerhouse 106.29552311000 703.30455198700 Lower Lake Falls Powerhouse Constructed on Mersey Bulkhead Dam bedrock 31.91727846300 62.59852165650 Mersey Lower Lake Falls Sluiceway 57.46886696330 179.49953427300 Lower...

AI summary The text lists various infrastructure components and their construction details for the Mersey Lower Lake Falls and Upper Lake Falls sites, including powerhouses, dams, sluiceways, and spillways, along with associated measurements and materials used.

core 330.19841284500 3973.91103258000 Upper Lake Falls Dam & Earthfill with concrete Mersey Spillway Large core 785.38019987700 18700.14890110000 Upper Lake Falls Right Wing Constructed on Mersey Dam bedrock 69.98676788940 286.91214529100...

AI summary The text provides details on various infrastructure components, including dams and spillways, with specifications such as materials used and costs. Some parts of the document are redacted due to confidentiality.

271.92652107100 4511.26095289000 Nictaux 323.81627117900 5954.50762060000 Paradise Corbett Lake Dam Small Earthfill 311.93161115000 2719.31600657000 Spillway build on Paradise Neives Lake Dam Small bedrock Earthfill Yes 270.22778645300 437...

AI summary The text presents a list of infrastructure projects with associated costs and details, including dams, pipelines, and pump stations in various locations such as Nictaux, Paradise, and Corbett Lake. Each entry includes the project name, type, and associated numerical values.

Earthfill timbercore Sheet Harbour Sloane Dam Small embankment 925.85317889900 8932.82518810000 Sheet Harbour Ten Mile Lake Dam Decommissioned 335.38422787100 6364.05797749000

AI summary The text lists two dams with their locations, statuses, and associated measurements, likely related to infrastructure planning or asset management in Nova Scotia.

Small Timber 211.15810104900 1711.58417114000 Sissiboo Grand Lake Wing Sissiboo Dam Small Freeboard Dam Earthfill 393.34145672600 3533.41513879000 Weymouth Falls Main Dam - Sissiboo and Wing Dam Large Earthfill 1526.47815049000 55009.29779...

AI summary The text provides technical data on various dam and infrastructure projects, including details on their size, type, and associated costs. It includes entries for the Sissiboo Grand Lake Wing Dam, Weymouth Falls Main Dam, and spillway structures, along with associated numerical values.

NFIDENTIAL INFORMATION REMOVED) REDACTED Hydro Asset Study Appendix F Page 142 of 146

AI summary The document contains a redacted section of a Hydro Asset Study Appendix, which is part of a regulatory proceeding. Due to confidentiality, specific details are not provided, but the content likely relates to asset management or infrastructure planning.

REDACTED (CONFIDENTIAL INFORMATION REMOVED) REDACTED Hydro Asset Study Appendix F Page 143 of 146 System Name Classification Foundation Type Cleared Shape_Leng Shape_Area Tusket Canal Embankment Small Leave in place Earthfill 353.446066576...

AI summary The text provides a table listing various hydro system assets, including dams and embankments, with details such as their names, classifications, foundation types, and dimensions. It includes information about the Tusket system and associated infrastructure.

Wreck Cove D1 Medium Rockfill Yes 1941.62761881000 81749.48008450000 Wreck Cove D1 Spillway Medium Spillway on bedrock Rockfill Yes 1677.94434791000 28802.63475560000 Wreck Cove D10 Medium Earthfill 590.01352902500 16820.32620140000 Wreck...

AI summary The text presents a table with data on various structures at Wreck Cove, including details such as structure names, sizes, materials, and associated costs. The table includes information on dams, spillways, and other infrastructure.

Nova Scotia Utility and Review Board IN THE MATTER OF The Public Utilities Act, R.S.N.S. 1989, c.380, as amended 2019 Ten Year System Outlook NS Power July 2, 2019 NON-CONFIDENTIAL 2019 Ten-Year System Outlook NON-CONFIDENTIAL

AI summary This document is a 2019 Ten-Year System Outlook submitted by NS Power under the Public Utilities Act, R.S.N.S. 1989, c.380. It outlines the utility's long-term infrastructure and operational planning, though no specific arguments or data are detailed in the provided text.

2019 NON-CONFIDENTIAL 2019 Ten-Year System Outlook NON-CONFIDENTIAL

AI summary The document titled '2019 Ten-Year System Outlook' is marked as non-confidential. It outlines a long-term planning document for a utility or regulatory body, though no specific content or details are provided in the excerpt.

1 TABLE OF CONTENTS 2 3 1.0 INTRODUCTION ............................................................................................................... 5 4 2.0 LOAD FORECAST ...................................................................

AI summary The document outlines a regulatory proceeding's table of contents, covering topics such as load forecasting, generation resources (including existing capacity, unit utilization, and investment strategies), energy mix evolution, and projections for new supply-side facilities in Nova Scotia.

Page 2 of 67 2019 Ten-Year System Outlook NON-CONFIDENTIAL

AI summary The chunk marks the beginning of a 2019 Ten-Year System Outlook document, though no substantive content is visible beyond the page header and classification label. The text provides no details about system planning, stakeholders, or regulatory issues.

1 TABLE OF FIGURES 2 3 Figure 1: Net System Requirement with Future DSM Program Effects (actuals are not adjusted for 4 weather) .................................................................................................................

AI summary The document lists figures analyzing demand-side management (DSM) program impacts on system requirements, generating capacity, energy mix forecasts, and infrastructure investments. Key themes include DSM effects on peak demand, firm generating capability, energy mix trends, and transmission/distribution interconnection queues.

& Distribution Advanced Stage Interconnection Queue as of June 4th, 16 2019 ............................................................................................................................................................ 28 17...

AI summary The text lists figures related to energy generation projects, greenhouse gas emissions compliance, load and capacity analysis, and interconnection queues. Key themes include emissions caps, resource planning, and transmission infrastructure.

NSR Growth Year (GWh) (%) 2009 12,073 -3.7% 2010 12,158 0.7% 2011 11,907 -2.1% 2012 10,475 -12.0% 2013 11,194 6.9% 2014 11,037 -1.4% 2015 11,098 0.5% 2016 10,809 -2.6% 2017 10,873 0.6% 2018 11,250 3.5% 2019 11,331 0.7% 2020 11,300 -0.3% 20...

AI summary The document presents historical and forecasted Net System Requirement (NSR) growth from 2009 to 2029, showing fluctuating trends. NS Power forecasts peak hourly demand using regression models combining end-use energy forecasts and weather data, with peak demand occurring between December and February due to weather-sensitive loads.

Winter Net Facility Fuel Type Capacity (MW) Avon Hydro 6.8 Black River Hydro 22.5 Lequille System Hydro 24.2 Bear River System Hydro 37.4 Tusket Hydro 2.4 Mersey System Hydro 42.5 St. Margaret’s Bay Hydro 10.8 Sheet Harbour Hydro 10.8 Dick...

AI summary The text lists hydroelectric and thermal power facilities in Nova Scotia with their capacities, highlighting hydro's dominance (377.1 MW total) and the presence of thermal plants like Tufts Cove (318 MW) and Trenton (partial data).

377.1 Tufts Cove Heavy Fuel Oil/Natural Gas 318 Trenton Coal/Pet Coke/Heavy Fuel Oil 304 Point Tupper Coal/Pet Coke/Heavy Fuel Oil 150 Lingan Coal/Pet Coke/Heavy Fuel Oil 607 Coal/Pet Coke & Limestone Sorbent Point Aconi 168 (CFB) Total St...

AI summary The document lists power generation units in Nova Scotia with their fuel types and capacities, including the Annapolis Tidal unit's firm capacity based on average peak performance. It references the 2019 Ten-Year System Outlook and is dated July 2, 2019, as part of a regulatory filing.

hange 195 Projected Over Planning Period Community Feed-in Tariff (Firm capacity) 1 7 DSM Firm Peak Reduction is calculated from the 2019 NS Power 10-Year Energy and Demand Forecast, M09191, Exhibit N-1, Table A-3 and A-4, April 30, 2019....

AI summary The document outlines projected energy resources and retirements from 2019-2028, including biomass (43 MW), Maritime Link imports (153 MW), and assumed retirements (-148 MW), resulting in a net 49 MW increase. It references the 2019 NS Power 10-Year Forecast (Exhibit N-1, Table A-3/A-4) and mentions the Tusket Combustion Turbine as part of the planning period.

etter to address the Board’s 18 concerns regarding the requirement for the Tusket CT for system security, operating 19 reserve requirements, and cost-benefit alternatives analysis. 8 The transmission upgrades being completed for the Mariti...

AI summary The document discusses NS Power's plans for the Tusket CT's system security and operating reserve requirements, the impact of Maritime Link transmission upgrades on firm capacity (43 MW from PH Biomass), and the retirement of Lingan 2. It also outlines NS Power's assessment of Mersey Hydro System redevelopment due to aging infrastructure.

hydroelectric 12 production. The Company is preparing a Mersey Redevelopment Project Application for 13 filing with the UARB. 14 15 3.3 Unit Utilization & Investment Strategy 16 17 The following sub-sections provide an updated Unit Utiliza...

AI summary The document outlines NS Power's Mersey Redevelopment Project Application to the UARB and discusses the Unit Utilization & Investment Strategy (UUIS), which includes 10-year projections influenced by regulatory changes, operational experience, and market factors. It emphasizes integration of asset management and generation planning techniques to address evolving energy demands and renewable integration.

Page 17 of 67 2019 Ten-Year System Outlook NON-CONFIDENTIAL

AI summary Page 17 of a 67-page non-confidential document titled '2019 Ten-Year System Outlook' is referenced, indicating it contains long-term planning or forecasting related to the electricity system.

25 10 - 25 10 - 25 25 - 50 25 - 50 25 - 50 10 - 25 10 - 25 10 - 25 10 - 25 Service Hours 1496 1210 2203 4182 3401 4602 3476 4218 4249 4304 Tufts Cove 4 Capacity Factor (%) 46 47 61 60 60 64 66 67 64 64 Unit Cycles (Ranges) 0 > 100 50 - 100...

AI summary The text presents operational data (service hours, capacity factors, unit cycles) for Tufts Cove units 4, 5, and 6 over various periods, which are part of the 2019 Ten-Year System Outlook and Projections of Unit Sustaining Investment. This data is used for infrastructure planning and assessing system reliability.

Page 18 of 67 2019 Ten-Year System Outlook NON-CONFIDENTIAL 1 3.3.3 Projections of Unit Sustaining Investment 2 Unit utilization and reliability objectives have long been the drivers for generator 3 investment planning. Traditionally, in a...

AI summary NS Power is updating its generator investment planning to account for variable renewable integration, introducing a utilization factor (UF) that considers capacity factors, operating hours, unit starts, two-shifting, and asset health to better reflect generator value and operational demands.

e operational capabilities, 18 the value brought to the power system by these units is more clearly reflected. Refer to 19 Figure 8 below. 20 21 Figure 8: Utilization Factor 22 23 The UF parameters are assessed to more completely describe...

AI summary The document discusses the Utilization Factor (UF) parameters, emphasizing their role in assessing the operational outlook for the steam fleet and guiding direct investment planning. It highlights the Capacity factor as a key component of unit utilization, reflecting energy production contributions of generating units.

July 2, 2019 Page 20 of 67 2019 Ten-Year System Outlook NON-CONFIDENTIAL

AI summary This document provides the 2019 Ten-Year System Outlook, a non-confidential overview of the electricity system's future planning and projections.

Page 22 of 67 2019 Ten-Year System Outlook NON-CONFIDENTIAL

AI summary This document presents the 2019 Ten-Year System Outlook, providing a non-confidential overview of the electricity system's future performance and planning considerations.

1 Figure 10: Forecast Annual Investment (in 2019$) by Unit $110,000,000 TUC6 $100,000,000 TUC3 $90,000,000 TUC2 TUC1 $80,000,000 TUC0 $70,000,000 TRN6 TRN5 $60,000,000 TRN0 $50,000,000 POT POA $40,000,000 LMs $30,000,000 LIN4 LIN3 $20,000,...

AI summary The text presents a figure showing forecast annual investment by unit in 2019 dollars, with various labeled components such as TUC6, TUC3, TUC2, TUC1, TUC0, TRN6, TRN5, TRN0, POT, POA, LMs, LIN4, LIN3, LIN2, LIN1, and LIN0 across the years 2020 and 202.

LIN1 LIN0 $0 2020 2021 2022 2023 2024 2025 2026 2027 2028 2029 2 3 Note: Figure does not include escalation as it is used for asset planning. DATE FILED: July 2, 2019 Page 23 of 67 2019 Ten-Year System Outlook NON-CONFIDENTIAL 1 Figure 11:...

AI summary The document provides a forecast of annual investment by asset class from 2020 to 2029, excluding escalation for asset planning purposes. It includes categories such as turbine, routine, other, LMs, I&E, generator, and fuel systems.

FW $40,000,000 Fuel Systems $30,000,000 Env&Emiss CW $20,000,000 CTs $10,000,000 Boiler $0 2020 2021 2022 2023 2024 2025 2026 2027 2028 2029 2 3 Note: Figure does not include escalation as it is used for asset planning. Forecast investment...

AI summary The text presents a financial projection for capital investments, highlighting a significant sustaining capital investment for Tufts Cove Unit #2 in 2028. NS Power plans to evaluate replacement options for the unit based on Synapse Energy Economics Inc.'s Generation Utilization and Optimization study, as part of the upcoming Integrated Resource Plan (IRP).

2 As stated in NS Power’s submission to the UARB dated June 7, 2018 in regard to 3 Synapse’s Generation Utilization and Optimization report (M08059) filed on May 1, 4 2018:12 5 6 Synapse’s results provide a direct answer to the Board’s que...

AI summary NS Power asserts that retaining the coal fleet through 2030 is cost-effective for rate payers based on Synapse’s report. However, the long-term utilization of these units depends on the carbon regime to be implemented in Nova Scotia. NS Power expects clarity on this by the end of 2018, potentially enabling an Integrated Resource Planning (IRP) exercise in 2019.

Page 33 of 67 2019 Ten-Year System Outlook NON-CONFIDENTIAL

AI summary The document presents the 2019 Ten-Year System Outlook, providing a non-confidential overview of the electricity system's future planning and projections.

Page 37 of 67 2019 Ten-Year System Outlook NON-CONFIDENTIAL

AI summary This document presents the 2019 Ten-Year System Outlook, providing a non-confidential overview of the electricity system's future needs and planning considerations for Nova Scotia.

Page 38 of 67 2019 Ten-Year System Outlook NON-CONFIDENTIAL

AI summary The 2019 Ten-Year System Outlook provides a non-confidential overview of the electricity system's future needs and planning considerations for the next decade.

Page 42 of 67 2019 Ten-Year System Outlook NON-CONFIDENTIAL 1 neighboring Planning Coordinator Areas, transmission transfer 2 capabilities, and capacity and/or load relief from available operating 3 procedures. 4 5 The 2014 IRP Loss of Loa...

AI summary The 2019 Ten-Year System Outlook discusses the 2014 IRP LOLE study, confirming the 20% planning reserve margin (PRM) required by NS Power to meet NPCC reliability criteria. NS Power is updating the LOLE study to establish the PRM for the next planning cycle. The PRM is a minimum requirement, not the optimal capacity for other system needs like load-following and emissions compliance.

ty requirement is determined through a long-term planning exercise such as an 18 IRP, as discussed in Section 7.4. 19 20 7.3 Capacity Contribution of Renewable Resources in Nova Scotia 21 22 Due to their variability, renewable energy resou...

AI summary The document discusses the determination of capacity requirements through long-term planning exercises like the Integrated Resource Plan (IRP) and the capacity contribution of renewable resources in Nova Scotia. It emphasizes the variability of renewable resources and the use of Effective Load Carrying Capability (ELCC) and Loss of Load Expectation (LOLE) studies for system planning.

Page 43 of 67 2019 Ten-Year System Outlook NON-CONFIDENTIAL

AI summary The 2019 Ten-Year System Outlook provides a non-confidential overview of the electricity system's future needs and planning considerations for the next decade in Nova Scotia.

1 In its letter dated October 5, 201828 the UARB directed NS Power to complete a number 2 of pre-IRP analyses by July 31, 2019. One of these pre-IRP deliverables is a Capacity 3 Study which will calculate the ELCC of wind and other renewab...

AI summary The UARB directed NS Power to complete a Capacity Study as part of the pre-IRP analyses, which includes calculating the ELCC of wind and other renewable energy generators, evaluating the role of energy storage, and updating system capacity values for future planning. The study will influence future 10-Year System Outlook Reports and long-term resource planning.

Page 44 of 67 2019 Ten-Year System Outlook NON-CONFIDENTIAL 1 operate as though they are NRIS facilities and therefore can contribute to system capacity 2 for the purposes of resource planning at this time without the requirement for addit...

AI summary NS Power has applied a 17% capacity value to existing wind resources in the 2019 Ten-Year System Outlook, considering them as contributing to system capacity without requiring additional upgrades. This approach is new and subject to change as more information becomes available.

refine the capacity 15 estimates as required. Changes, if necessary, will be incorporated within future 10-Year 16 System Outlook Reports. 17 18 7.4 Load and Resources Review 19 20 The ten-year Load and Resources Outlook in Figure 22 and F...

AI summary The document discusses the need to refine capacity estimates and updates the 10-Year System Outlook Reports. It highlights a current forecast of a capacity deficit, which is expected to affect only one week in the coming years. NS Power is evaluating the Planning Reserve Margin in the upcoming Integrated Resource Plan (IRP) to comply with NPCC criteria and determine the optimal resource mix.

Page 45 of 67 2019 Ten-Year System Outlook NON-CONFIDENTIAL

AI summary The document presents the 2019 Ten-Year System Outlook, providing a non-confidential overview of the electricity system's future performance and planning considerations.

not the only 23 constraint that dictates how much capacity might be required on the 24 system. Plexos’ ability to model hourly dispatch requirements means that 25 any ramping requirements must be met with adequate capacity. Also, the 26 pr...

AI summary The document discusses the complexity of capacity planning in the Nova Scotia power system, emphasizing the need to consider both long-term planning and short-term dispatch requirements. It highlights the influence of emissions constraints and the multi-fuel thermal fleet on capacity needs, as well as the importance of integrated modeling in making optimal retirement and build decisions.

ement, including 8 addressing a capacity shortfall and the appropriateness of any unit retirements, is 9 determined through a long-term planning exercise such as an IRP. 30 Ibid at section 3.1, DATE FILED: July 2, 2019 Page 47 of 67 2019 T...

AI summary The document discusses the 10-year load and resources outlook for Nova Scotia Power, including firm peak load forecasts from 2019/2020 to 2028/2029. It references the Integrated Resource Plan (IRP) as a long-term planning exercise to address capacity shortfalls and determine unit retirements.

18% 18% 18% 18% 17% 17% 18% 18% 18% 19% 31 Cumulative estimated Firm Peak reduction based on DSM forecast 32 Includes assumed Lingan 2 retirement once Maritime Link Base Block provides firm capacity service. 33 43 MW from the PH Biomass pl...

AI summary The document discusses NS Power's 2019 Ten-Year System Outlook, focusing on system demand, planning reserve margin, and capacity assessments. It outlines the Firm Peak reduction based on DSM forecasts and mentions the impact of the Maritime Link Base Block and the Community Feed-in-Tariff on system capacity.

2019 Page 51 of 67 2019 Ten-Year System Outlook NON-CONFIDENTIAL

AI summary The 2019 Ten-Year System Outlook provides a non-confidential overview of the electricity system planning and projections for the next decade, focusing on key aspects such as generation, grid reliability, and resource planning.

y 2, 2019 Page 53 of 67 2019 Ten-Year System Outlook NON-CONFIDENTIAL

AI summary The document presents the 2019 Ten-Year System Outlook, providing a non-confidential overview of the utility's system planning and projections for the next decade.

1 2 (2) Consider conforming changes to NPCC documents to implement any necessary 3 improvements as a result of the review. 4 5 NS Power has representation on the A-10 Working group that performed the review for 6 TFCP. Throughout 2018, Web...

AI summary The document discusses the review and potential improvements to NPCC documents, with NS Power participating in the A-10 Working group. Three proposals were tested in 2018: a revised A-10 methodology, a performance-based methodology, and a connectivity-based methodology, all aimed at identifying critical facilities based on NPCC criteria.

criteria. The objective of this methodology is to pursue a non-performance based 28 method to identify critical facilities to which NPCC Directory #1 and Directory #4 29 may be applied. 30 DATE FILED: July 2, 2019 Page 55 of 67 2019 Ten-Ye...

AI summary The document outlines a methodology for identifying critical facilities using a non-performance-based approach, referencing NPCC Directory #1 and Directory #4. It is part of the 2019 Ten-Year System Outlook filing.

2019 Page 55 of 67 2019 Ten-Year System Outlook NON-CONFIDENTIAL

AI summary The 2019 Ten-Year System Outlook provides a non-confidential overview of the power system planning and forecasting for the next decade, highlighting key considerations and projections for the Bulk Electric System.

ion of asset replacement (for example, conductor, poles, cross-arms, guywires, 27 and hardware replacement). 28 29 Transmission line inspections consist of the following actions: 30 DATE FILED: July 2, 2019 Page 56 of 67 2019 Ten-Year Syst...

AI summary The document outlines the process of asset replacement for transmission lines, including components such as conductor, poles, cross-arms, guywires, and hardware. It also mentions the inspection procedures for transmission lines.

19 Page 56 of 67 2019 Ten-Year System Outlook NON-CONFIDENTIAL

AI summary The document presents the 2019 Ten-Year System Outlook, providing a non-confidential overview of the Bulk Electric System (BES) and related planning efforts, including coordination tasks and system studies.

1 • Visual inspection of every line once per year via helicopter, or via ground patrol 2 in locations not practical for helicopter patrols. 3 • Foot patrol of each non-BPS (Bulk Power System) line on a three year cycle. 4 Where a Lidar sur...

AI summary The text outlines inspection protocols for power lines, including annual helicopter or ground patrols, three-year foot patrols for non-BPS lines, and biennial Lidar surveys for BPS lines. It also discusses the transmission project approval process, emphasizing the need for system reliability, compliance with standards, and potential changes due to technical studies or regulatory approvals.

t, changes in 26 customer requirements or other matters determined by NS Power, NPCC/NERC 27 Reliability Standards, or the UARB. 28 29 In 2008, the Maine and Atlantic Technical Planning Committee (MATPC) was 30 established to review intra-...

AI summary The text discusses the establishment of the Maine and Atlantic Technical Planning Committee (MATPC) in 2008 to review intra-area plans for regional resource integration and transmission. It also references changes in customer requirements and reliability standards.

Page 57 of 67 2019 Ten-Year System Outlook NON-CONFIDENTIAL

AI summary This document provides a non-confidential overview of the 2019 Ten-Year System Outlook, focusing on long-term planning and projections for the electricity system.

019 Page 59 of 67 2019 Ten-Year System Outlook NON-CONFIDENTIAL

AI summary The document outlines the 2019 Ten-Year System Outlook, providing a non-confidential overview of the future direction and planning for the electricity system in Nova Scotia.

1 9.0 TRANSMISSION DEVELOPMENT 2019 TO 2029 2 3 9.1 Impact of Proposed Load Facilities 4 5 As noted in Section 8.5 of this report, there are a number of system upgrades that may be 6 required to serve new cannabis facilities that are being...

AI summary The text discusses the impact of proposed cannabis facility load upgrades on Nova Scotia's transmission system, outlining specific substation and transformer upgrades needed by 2019/2020. It also outlines 2019 transmission development plans, including an uprating of the 2C Port Hastings 138kV substation to meet NPCC BPS standards.

identified through the IRP process. 27 28 2019 29 • 2C Port Hastings 138kV substation will be uprated to meet NPCC BPS standards 30 (moved from 2018). DATE FILED: July 2, 2019 Page 60 of 67 2019 Ten-Year System Outlook NON-CONFIDENTIAL

AI summary The 2019 Ten-Year System Outlook discusses the uprating of the 2C Port Hastings 138kV substation to meet NPCC BPS standards, which was moved from the 2018 plan to 2019.

2, 2019 Page 60 of 67 2019 Ten-Year System Outlook NON-CONFIDENTIAL

AI summary The document presents the 2019 Ten-Year System Outlook, providing a non-confidential overview of the electricity system's future planning and projections.

1 • New 12MVA Mount Hope 69kV-25kV substation in Dartmouth (moved from 2 2018) 3 • 5P 25MVA Mobile Substation Replacement 4 • 6S Terrace Street 69 kV substation will be retired once the existing 4 kV 5 distribution load is converted to 12...

AI summary The text outlines various infrastructure projects and replacements within the Nova Scotia power grid, including substation upgrades, transformer replacements, and right-of-way widenings aimed at improving system reliability and accommodating load growth.

om 27 4kV to 25kV. CI:52328 28 • Transmission Right of Way Widening 69kV to reduce the occurrence of edge and 29 off right of way tree contacts (Year 5 of 8) DATE FILED: July 2, 2019 Page 61 of 67 2019 Ten-Year System Outlook NON-CONFIDENT...

AI summary The document outlines a series of infrastructure upgrades and replacements for the transmission and distribution system over the years 2019 to 2026, including transformer replacements, right of way widening, and new installations to improve reliability and reduce tree contact incidents.

expected life with a single 25 138/69kV-25kV, 15/20/25MVA transformer 26 • Add a second 25/33/42 MVA , 138kV-25kV transformer at new Stellarton 27 substation DATE FILED: July 2, 2019 Page 62 of 67 2019 Ten-Year System Outlook NON-CONFIDENT...

AI summary The text outlines a proposal to add a second transformer at the new Stellarton substation as part of the 2019 Ten-Year System Outlook, highlighting infrastructure planning and expansion efforts in Nova Scotia's power system.

9 Page 63 of 67 2019 Ten-Year System Outlook NON-CONFIDENTIAL

AI summary The document presents the 2019 Ten-Year System Outlook, providing a non-confidential overview of the Bulk Electric System (BES) and related planning efforts for Nova Scotia's electricity infrastructure.

1 are not connected to BES buses and the Transmission Owner has not been 2 identified them as BES buses requiring sequence-of-events and fault recording 3 capabilities. 4 5 3. At 1N Onslow and 103H Lakeside there are deficiencies in the mo...

AI summary The text discusses deficiencies in monitoring capabilities at specific substations and updates regarding the correct location of a site mentioned in a prior report. It also outlines a study initiated in 2017 to address transmission line capacity, clearance, and age issues in the Western Valley over a 15-year planning horizon.

28 29 The scope of the study is to assess four options for dealing with the clearance, age, and 30 capacity issues on Lines L-5531 (13V-Gulch to 15V-Sissiboo), L-5532 (13V-Gulch to DATE FILED: July 2, 2019 Page 64 of 67 2019 Ten-Year Syste...

AI summary The text outlines a study assessing four options to address clearance, age, and capacity issues on specific power lines in Nova Scotia. The study was deferred in 2018 but is expected to be completed in 2019. The options include restoring lines to different temperature ratings and rebuilding them with various conductor types and voltage levels.

ly 2, 2019 Page 65 of 67 2019 Ten-Year System Outlook NON-CONFIDENTIAL

AI summary The document provides a non-confidential overview of the 2019 Ten-Year System Outlook, focusing on long-term planning and projections for the electricity system.

1 10.0 CONCLUSION 2 3 Customers count on NS Power for energy to power every moment of every day, and for solutions 4 to power a sustainable tomorrow. Environmental legislation in Canada and Nova Scotia 5 continues to drive a transformation...

AI summary NS Power is preparing for environmental regulations that will require increased renewable energy use and reduced emissions. The company is forecasting a potential capacity deficit and is participating in an Integrated Resource Planning (IRP) process to address future energy needs, including studies on renewable energy and demand response programs.

re being developed to study specific DR programs. 27 28 The outcome of this IRP process will impact and inform all future Ten-year System Outlook 29 Reports and related long term planning processes. The Company expects the IRP will provide...

AI summary The 2019 Ten-Year System Outlook discusses the impact of the Integrated Resource Plan (IRP) on future planning processes, including the need to address potential capacity deficits and the role of transmission planning, particularly in relation to new load facilities and the Maritime Link.

(TOR) for the 2020 IRP. NS Power next circulated the draft TOR to stakeholders and requested comments and feedback. Comments were received from the following parties: December 16, 2019 D. Friis Stakeholder (and Consultant) Comments Receive...

AI summary NS Power circulated the draft TOR for the 2020 IRP, receiving stakeholder comments from organizations like Efficiency One, Consumer Advocate, and Halifax Regional Municipality. A matrix (Appendix B) summarizes comments and NS Power's responses, with some stakeholders planning further input by late December 2019.

December 2019 Attached are the comments received from the stakeholders as of today’s date and a matrix (Appendix B) setting out all comments by category and indicating NS Power’s response. Many of the comments received were with respect to...

AI summary NS Power submitted stakeholder comments on the 2020 Integrated Resource Plan (IRP) process, revised the Terms of Reference (TOR), and requested approval for the draft TOR. The document outlines stakeholder feedback on scenario development, evaluation criteria, and modeling approaches, emphasizing ongoing engagement during IRP phases.

elopment Goals Act, which established provincial greenhouse gas emission reduction goals of at least 10% below 1990 levels by 2020; at least 53% below 2005 levels by 2030; and “at net zero” by 2050. A growing consensus of economy-wide stud...

AI summary The text outlines Nova Scotia's greenhouse gas emission reduction targets under the Sustainable Development Goals Act, emphasizing the role of electrification in decarbonization. It highlights the need for the 2020 Integrated Resource Plan (IRP) to address renewable energy integration, coal replacement, and grid modernization to meet climate commitments while ensuring system reliability.

d units, and how we can leverage new and existing technologies to preserve or enhance reliability and modernize the electricity system to create a smarter, more resilient grid on a least-cost basis. While policy continues to direct decarbo...

AI summary The document discusses the need for Integrated Resource Planning (IRP) to modernize the electricity grid using renewable energy, battery storage, and distributed energy resources (DERs). It emphasizes evaluating transmission system capabilities, addressing DER operational challenges, and leveraging technological advancements to achieve a reliable, low-cost grid.

capabilities and limitations, and how new transmission investments 1 and potential regional interconnections can enable further integration of renewable resources and complement a resource portfolio. In 2018, the Federal Government amended...

AI summary NS Power's Integrated Resource Plan (IRP) addresses renewable integration, coal plant phase-out timelines, and evaluation criteria for resource portfolios. The Federal Government's 2018 regulations mandate coal closure by 2029, but Nova Scotia seeks an equivalency agreement to allow limited coal operation until 2040. The IRP will prioritize affordability, GHG reductions, and reliability, with E3 as the lead consultant.

(E3) as its primary consultant for the IRP process. 1 Transmission investments include “poles and wires” as well as stability resources such as synchronous condensers and static var compensators. 3 IRP Terms of Reference Consultation Appen...

AI summary The 2020 Integrated Resource Plan (IRP) aims to develop a risk-weighted least-cost electricity strategy ensuring reliability, decarbonization through non-emitting resources, and customer affordability. It also seeks to create an action plan for implementation and establish a collaborative, transparent resource planning process in Nova Scotia.

esource planning 3 process in Nova Scotia that reflects industry best practices in the area of resource planning and promotes understanding and consensus among interested parties. Purpose of the 2020 IRP The IRP is a comprehensive public u...

AI summary The 2020 Integrated Resource Planning (IRP) process in Nova Scotia is a non-prescriptive, comprehensive planning exercise integrating supply and demand-side resources to develop a long-term electricity strategy. It emphasizes flexibility to address uncertainties and is guided by collaboration with the Nova Scotia Utility and Review Board (UARB) and consultants.

RP process. The Company will complete the IRP in Terms of collaboration with the Nova Scotia Utility and Review Board’s (UARB) Reference staff and its consultants. Stakeholder input is integral to the IRP process, which will establish the...

AI summary NS Power will develop an Integrated Resource Plan (IRP) in collaboration with the Nova Scotia Utility and Review Board (UARB), emphasizing stakeholder engagement, transparency, and compliance with OATT Standards of Conduct. The process includes workshops, draft material reviews, and public input to shape Nova Scotia's electricity future.

5 IRP Terms of Reference Consultation Appendix A Page 7 of 12 Developing An Electricity Strategy for the Future The IRP process will seek to identify the least-cost, least-risk portfolio. Traditionally, the primary decision criterion used...

AI summary NS Power's Integrated Resource Planning (IRP) process aims to identify the least-cost, least-risk electricity portfolio over 25 years, using cumulative revenue requirement minimization as the primary metric while also evaluating reliability, emissions reduction, and plan robustness. Key considerations include rate impacts, grid stability, and decarbonization alignment.

y (limitation of constraints on future decisions environmental scenarios we arising from the selection of a particular path). should examine? An Analysis Plan will establish how these metrics will be used as the evaluation criteria for the...

AI summary The document outlines an Analysis Plan for Integrated Resource Planning (IRP) modeling, evaluating alternative electricity scenarios through capacity expansion, demand-side options, and operational feasibility. It emphasizes developing a long-term Strategy and Roadmap for Nova Scotia's electricity supply, considering uncertainty and risk assessment.

lts of the modeling will form a summary of findings, a long-term Strategy for electricity supply in Nova Scotia, and the development of a Roadmap and near-term Action Plan to implement the Strategy. NS Power's Integrated Resource Plan will...

AI summary NS Power's Integrated Resource Plan (IRP) will evaluate scenarios for replacing coal units by 2030 and 2040. The process includes developing an Analysis Plan detailing modeling approaches, evaluation criteria, and deliverables like the Draft & Final Analysis Plan to guide long-term electricity supply strategy implementation.

sumptions will be documented and, where possible, rely on independent and/or vetted publicly available information. Deliverables: Draft & Final Input Assumptions 7 IRP Terms of Reference Consultation Appendix A Page 9 of 12 Evaluate Potent...

AI summary The document outlines NS Power's process for developing an Integrated Resource Plan (IRP), including evaluating resource plans using modeling, compiling findings, and preparing a long-term strategy, roadmap, and action plan. The final IRP report will be submitted to the UARB.

lay out the long-term Strategy, Roadmap and Action Plan for the future of electricity supply in Nova Scotia. Deliverables: Draft & Final IRP Report 3 A Reference Plan for use in the avoided cost calculations of energy and capacity from DSM...

AI summary The document outlines the process for developing Nova Scotia's Integrated Resource Plan (IRP), including a reference plan for avoided cost calculations in demand-side management (DSM). It details a timeline of stakeholder consultations, workshops, and submissions to the UARB for approval of the IRP Terms of Reference.

n 20 2020 Assumptions & Analysis Plan stakeholder workshop(s) Feb 2020 Stakeholder comments on Draft Assumptions and Analysis Plan Feb 14 2020 Final Assumptions & Analysis Plan issued Mar 5 2020 Modeling phase begins Mar 2020 9 IRP Terms o...

AI summary The timeline outlines the 2020 Integrated Resource Plan (IRP) process, including stakeholder workshops, draft plan reviews, modeling phases, and submission of the final IRP report to the UARB by September 30, 2020.

risk weighting, risk assessment)? input on how NS Power’s IRP might be informed by the HalifACT initiative. AREA Objectives The Objectives suggest a preference for Objective 1 on page 3 refers to a “affordable” rates, but the Developing “r...

AI summary The document discusses a tension between 'affordable' rates and a 'least-cost' electricity strategy in Nova Scotia's Integrated Resource Plan (IRP), influenced by the HalifACT initiative. It highlights the need to prioritize minimizing cumulative present value of annual revenue requirements over the planning horizon, with the Energy and Analysis Committee (EAC) incorporating this into the Analysis Plan outlined in the Terms of Reference (TOR).

be considered as part of the Process & Deliverables Step 1 – Establish Analysis Plan as described on page 7 of the TOR. SBA Metrics NSP should establish a metric that is NS Power will incorporate this comment calculated with each case mode...

AI summary Stakeholders request NSP to establish metrics for rate impacts in the IRP and develop indicators for 'signposts.' NSP agrees to incorporate these into the Analysis Plan and Strategy Roadmap as outlined in the TOR.

14 IRP TERMS OF REFERENCE – STAKEHOLDER COMMENTS Stakeholder Issue Stakeholder Comments NS Power Response Category

AI summary The document outlines stakeholder comments on the Integrated Resource Plan (IRP) Terms of Reference (TOR), with NS Power providing responses. It highlights stakeholder engagement in the regulatory process related to the IRP.

iate weighting of these six metrics against each other and against the primary metric. EfficiencyOne recommends that if NS Power intends to use these six metrics in addition to the primary metric, it objectively define exactly how it will...

AI summary EfficiencyOne recommends NS Power objectively define how to weight six metrics in the TOR to avoid inconsistent stakeholder interpretations. NS Power agrees to include illustrative examples in the final IRP Report and engage stakeholders during the IRP process.

14 IRP TERMS OF REFERENCE – STAKEHOLDER COMMENTS Stakeholder Issue Stakeholder Comments NS Power Response Category

AI summary The document outlines stakeholder comments on the Integrated Resource Plan (IRP) Terms of Reference (TOR), with NS Power providing responses. It highlights stakeholder engagement in the regulatory process related to the IRP.

E1 Constraints / EfficiencyOne’s understanding of the NS Power agrees that the SDGA goals Assumptions Sustainable Development Goals Act1 will be critical in developing the (SDGA) is that the Province of Nova scenarios for the IRP. This com...

AI summary EfficiencyOne emphasizes the need for the electricity sector to reach net zero emissions before 2050 to enable broader electrification, while NS Power agrees that SDGA goals will shape IRP scenarios. The TOR should clarify how the IRP incorporates SDGA targets and emissions constraints.

NS Power will address this comment in Assumptions Atlantic Clean Energy Initiative and the its Assumptions and Analysis Plan. Clean Power Roadmap for Atlantic Canada will be considered in the IRP. E1 Constraints / The TOR should explain ho...

AI summary NS Power will address comments on the Atlantic Clean Energy Initiative and Clean Power Roadmap in its Assumptions and Analysis Plan for the IRP. The TOR outlines how carbon costs will be modeled, including consideration of revenue from carbon credit sales in revenue requirement calculations.

Assumptions and the Analysis Plan and discussed with stakeholders. E1 Constraints / The TOR should indicate whether NS This is covered as part of the Process & Assumptions Power plans to do any stochastics and if Deliverables Step 1 – Esta...

AI summary The document discusses the Terms of Reference (TOR) for an Integrated Resource Plan (IRP), focusing on whether NS Power will use stochastic methods in its analysis. Stakeholder input is mentioned, with NS Power indicating consideration of stochastic approaches but not yet confirming their necessity for this exercise.

14 IRP TERMS OF REFERENCE – STAKEHOLDER COMMENTS Stakeholder Issue Stakeholder Comments NS Power Response Category E1 Constraints / The TOR should indicate whether Short This is an item which will be addressed Assumptions Term runs will be...

AI summary Stakeholder E1 requested clarification on whether Short Term runs in the IRP will use hourly or five-minute intervals and if transmission/distribution systems are considered in the IRP. NS Power responded that these issues will be addressed in the Analysis Plan during the Process & Deliverables Step 1, as outlined in the TOR.

ge 7 of the TOR and discussed with stakeholders. CA Constraints / We appreciate the goal of “a robust, This is covered as part of the Process & Assumptions risk-weighted least-cost long-term Deliverables Step 1 – Establish Analysis electri...

AI summary The text discusses the Integrated Resource Plan (IRP) and its need to address two types of risks: those adaptable through future plan adjustments (e.g., gas price fluctuations) and those that alter post-decision economics (e.g., solar adoption stranding 2020s capacity). The IRP must prioritize the latter risks while acknowledging supply plan differences in accommodating the former.

September 2019. The minimization energy. exercise should be on cost to rate payers, not revenue requirement. AREA Constraints / Given that it has been shown that NSPI NS Power’s IRP will assess the least-cost Assumptions is no longer the l...

AI summary The text emphasizes minimizing energy costs for rate payers over revenue requirements, highlights NSPI's Integrated Resource Plan (IRP) assessing least-cost options for clean energy, and notes the absence of time for debate on asset ownership. It also mentions EAC scenarios advocating for a coal phase-out by 2030.

language about modelling efforts to explore a complete coal phase-out by 2030, and other dates where economic. E1 Scenarios The TOR should indicate that all This is covered as part of the Process & modeled scenarios will comply with Delive...

AI summary The text discusses modeling scenarios for a coal phase-out by 2030 and ensuring compliance with regulations as part of the Integrated Resource Plan (IRP) Terms of Reference. NS Power agrees to include a scenario where Canada eliminates CO2 emissions.

Input robust ‘what if’ testing. Assumptions and will be discussed with stakeholders. E1 Scenarios The TOR should describe the process by NS Power has not yet determined the which NS Power will engage with modeling plan and whether a stakeh...

AI summary The text discusses NS Power's Terms of Reference (TOR) for the Integrated Resource Plan (IRP), focusing on stakeholder engagement in developing Candidate Resource Plans and scenarios. It raises a question about whether stakeholders can propose their own plans for modeling alongside NS Power's, and notes that stakeholder engagement is planned regardless of the modeling methodology.

in the TOR regardless of the modeling methodology to be employed. E1 Modeling Greater clarity should be added to the This is an item which will be addressed TOR regarding how modelling results as part of the Analysis Plan, particularly wil...

AI summary EfficiencyOne seeks greater clarity in the Terms of Reference (TOR) regarding how modeling results will inform the Integrated Resource Plan (IRP) Strategy, Roadmap, and Draft Report. Concerns are raised about potential subjectivity in interpreting modeling outcomes due to insufficient objective linkage, with recommendations to address this through the Analysis Plan and evaluation criteria.

f 14 IRP TERMS OF REFERENCE – STAKEHOLDER COMMENTS Stakeholder Issue Stakeholder Comments NS Power Response Category E1 Outputs The TOR should specify that avoided NS Power agrees that the IRP modeling costs of capacity and energy due to D...

AI summary Stakeholder E1 requests that the IRP TOR explicitly include avoided capacity and energy costs from demand-side management (DSM) as outputs, calculated using the Difference-in-Revenue-Requirements (DCRR) method. NS Power agrees, updates the TOR to reflect this, and remains open to alternative methods during stakeholder consultation.

and energy due to DSM will inherently include this component. SWEB Miscellaneous With the Federal Government Changes to legislation are within the Development [Legislation] announcing a tentative RFP for purview of the Nova Scotia governme...

AI summary The text discusses the potential for changes in legislation to facilitate energy offtake deals outside the current restrictive Renewable to Retail market, specifically in Cape Breton. It raises questions about whether a special program is being considered to allow the Federal Government to purchase energy at a fixed PPA price, and how NSPI and the UARB plan to address these issues within the Integrated Resource Planning (IRP) process.

of 14 IRP TERMS OF REFERENCE – STAKEHOLDER COMMENTS Stakeholder Issue Stakeholder Comments NS Power Response Category SWEB Miscellaneous Also, is NSPI considering any other The IRP will assess further renewable Development [Legislation] re...

AI summary Stakeholders provided feedback on the Integrated Resource Planning (IRP) Terms of Reference, emphasizing the need for transparency, long-term planning, and stakeholder engagement. NS Power responded by agreeing to incorporate recommendations and ensure collaboration throughout the process.

NS Power agrees with this comment and Engagement horizon of the IRP, which we believe and has edited the TOR accordingly. recommend to be 25 years. E1 Process / Greater clarity should be added to the NS Power does not believe this is Engag...

AI summary NS Power agrees with the comment regarding the horizon of the Integrated Resource Plan (IRP), recommending a 25-year timeframe. It also discusses the Terms of Reference (TOR) and the need for clarity on the differences between the IRP Strategy, Roadmap, and Action Plan. NS Power plans to use a modernized approach to articulate its strategy and has updated the TOR to include a Reference Plan for calculating avoided costs due to demand-side management (DSM).

12 of 14 IRP TERMS OF REFERENCE – STAKEHOLDER COMMENTS Stakeholder Issue Stakeholder Comments NS Power Response Category E1 Schedule The “IRP kickoff stakeholder workshop” NS Power agrees with this comment and planned for Dec 2019/Jan 2020...

AI summary Stakeholder E1 requests that the Integrated Resource Planning (IRP) kickoff workshop be scheduled as soon as possible, with the date(s) communicated to stakeholders promptly and the agenda circulated in advance. NS Power agrees and commits to scheduling the workshop and sharing the agenda beforehand.

agenda in advance. the date(s) known to stakeholders as soon as possible and that the agenda be circulated in advance. E1 Schedule At least two additional weeks should be NS Power agrees with this comment and added to the schedule for revi...

AI summary The text discusses the need for additional time to review the Draft Analysis Plan and Assumptions as part of the Integrated Resource Planning (IRP) process. NS Power agrees with the suggestion and has updated the Terms of Reference (TOR) accordingly, emphasizing the importance of thorough review to ensure quality outcomes and effective modelling.

spent to better define these two components could assist in higher quality outcomes and more effective modelling runs. E1 Schedule EfficiencyOne anticipates that NS Power NS Power agrees with this comment and will receive extensive and mea...

AI summary EfficiencyOne suggests that NS Power should take more than a week to process stakeholder feedback on the Draft Assumptions and Analysis Plan before finalizing it, to ensure quality outcomes and effective modelling. NS Power agrees and has updated the TOR accordingly.

f 14 IRP TERMS OF REFERENCE – STAKEHOLDER COMMENTS Stakeholder Issue Stakeholder Comments NS Power Response Category E1 Schedule The TOR should clearly indicate exactly NS Power has not yet determined the when in the process stakeholders w...

AI summary Stakeholder E1 comments on the IRP Terms of Reference, suggesting that the TOR should specify when stakeholders will be involved in preparing Candidate Resource Plans for the IRP. NS Power responds that the modeling plan and methodology for the IRP are not yet determined and will be addressed as part of the Analysis Plan.

Page 14 of 14 IRP Terms of Reference Consultation Appendix C Page 1 of 2 From: Mason Baker Sent: Monday, December 9, 2019 1:20 PM To: Musgrave, Lindsay Cc: Rory Cantwell ; Jason Parisé Subject: RE: 2020 IRP - Draft Terms of Reference This...

AI summary Mason Baker inquires about how NSPI and the UARB plan to adjust legislation for an energy offtake deal outside the Renewable to Retail market, given a potential federal RFP for renewable energy generation in Montreal. He also asks if a special program is being considered to allow the federal government to purchase energy at a fixed PPA price.

ace outside of the extremely restrictive and cost prohibitive Renewable to Retail market? Is a special program being considered so that the Federal Government may buy this energy at a fixed PPA price? Also, is NSPI considering any other re...

AI summary Mason Baker is inquiring about the possibility of a special program allowing the Federal Government to purchase renewable energy at a fixed PPA price and whether NSPI is considering future renewable energy procurements or implementing legislation to allow generators to sell energy directly to load customers. A memorandum from Mark Robertson to Lindsay Musgrave discusses comments on the 2020 Integrated Resource Plan (IRP) Terms of Reference.

latory Technical Lead, EfficiencyOne Date: December 6, 2019 Re: NS Power Integrated Resource Plan (IRP): EfficiencyOne Comments on NS Power’s Draft 2020 IRP Terms of Reference EfficiencyOne appreciates the opportunity to provide comments o...

AI summary EfficiencyOne provides comments on NS Power’s draft 2020 Integrated Resource Plan (IRP) Terms of Reference (ToR), supporting its alignment with climate change initiatives and decarbonization. EfficiencyOne recommends clarifying the planning horizon, the differences between the IRP Strategy, Roadmap, and Action Plan, and how modelling results will inform the IRP development process.

esults. 4. The ToR should be modified to indicate that NS Power will select a Preferred Resource Plan and on what basis that decision will be made (i.e. interaction between objective 1 IRP Terms of Reference Consultation Appendix D Page 2...

AI summary The document outlines several recommendations for modifying the Terms of Reference (TOR) for the Integrated Resource Plan (IRP), including the need for NS Power to select a Preferred Resource Plan based on specific criteria, the development of performance indicators, and the inclusion of transmission and distribution system considerations. It also emphasizes the importance of regulatory compliance in modeled scenarios and suggests scheduling the IRP kickoff stakeholder workshop as soon as possible.

er workshop” planned for Dec 2019/Jan 2020 should be scheduled as soon as possible, have the date(s) known to stakeholders as soon as possible and that the agenda be circulated in advance. 9. At least two additional weeks should be added t...

AI summary EfficiencyOne recommends scheduling the 'IRP workshop' as soon as possible, adding additional time for review of the Draft Analysis Plan and Draft Assumptions, and ensuring stakeholders are involved in the preparation of Candidate Resource Plans to improve the quality of the Integrated Resource Planning process.

IRP Terms of Reference Consultation Appendix D Page 3 of 4 MEMORANDUM Scenarios Recommendation 12. The ToR should describe the process by which NS Power will engage with stakeholders to develop Candidate Resource Plans, and how NS Power wi...

AI summary This text discusses recommendations for the Terms of Reference (TOR) for the Integrated Resource Plan (IRP), including stakeholder engagement in scenario development, consideration of the Sustainable Development Goals Act (SDGA), the Atlantic Clean Energy Initiative, the Clean Power Roadmap, and the inclusion of carbon costs in modelling. It also raises questions about stochastic analysis and carbon credit revenues.

be accounted for in the revenue requirement calculation for each scenario? 16. The ToR should indicate whether NS Power plans to do any stochastics and if so, on which variables. 17. The ToR should indicate whether Short Term runs will be...

AI summary The text discusses the need for the Integrated Resource Planning (IRP) Terms of Reference (ToR) to clearly define secondary metrics for evaluating resource plans, such as flexibility and robustness, to avoid inconsistent interpretations by stakeholders. The primary metric is the cumulative present value of annual revenue requirements, which is quantifiable and easily understood.

o so in the ToR. Not making this decision now leaves the door open for stakeholders to put inconsistent emphases on a subset of these metrics down the road, or to abandon them entirely. Outputs Recommendation 19. The ToR should specify tha...

AI summary The document recommends that the Terms of Reference (ToR) for the Integrated Resource Plan (IRP) should specify how avoided costs related to capacity, energy, transmission, distribution, and environmental compliance due to Demand-Side Management (DSM) will be treated as outputs or inputs to the IRP, and how they will be developed. EfficiencyOne acknowledges NS Power's opportunity to comment on the ToR and looks forward to collaboration.

es A. MacDuff Direct +1 (902) 444 8619 [email protected] Purdy's Wharf Tower II 1300-1969 Upper Water Street PO Box 730 Halifax NS Canada B3J 2V1 Tel +1 (902) 425 6500 Fax +1 (902) 425 6350 Our File: 179164 December 6, 2019 M...

AI summary Port Hawkesbury Paper LP (PHP) supports the draft Terms of Reference for the Integrated Resource Plan (IRP) 2020 but suggests adding an opportunity for stakeholder comments after the March 2020 Interim Modeling Progress workshop.

ight be productive to add an opportunity in the schedule for stakeholders to submit written comments following that workshop for consideration by NS Power’s team and the Board’s staff and consultants. PHP is appreciative of NS Power’s effo...

AI summary The document discusses the submission of written comments by stakeholders following a workshop, and appreciation for NS Power’s comprehensive Terms of Reference. It also mentions a draft of the Integrated Resource Planning (IRP) Terms of Reference and a request for feedback.

ference This is an external email - exercise caution My apologies. John and I drafted some notes, but I never got around to sending them. So here’s a quick summary of our thoughts: Scope Issues: 1. We appreciate the goal of “a robust, risk...

AI summary The text discusses concerns related to the Integrated Resource Plan (IRP), highlighting the need to address two types of risk in long-term electricity strategy planning. It emphasizes the importance of reliability analysis in the Terms of Reference (ToR) and raises concerns about the proposed schedule for stakeholder comments on modeling results.

ts: Final Modeling results circulated to stakeholders June 4 2020 Final Modeling & Analysis stakeholder workshop June 2020 Stakeholder comments on Modeling & Analysis June 18 2020 If the modeling is really final, it is not clear how useful...

AI summary The text discusses concerns about the timing and usefulness of stakeholder feedback on final modeling results for the Integrated Resource Plan (IRP). It highlights the potential lack of value in providing feedback after final results are circulated, suggesting earlier sharing of interim results could yield more meaningful input. The text also references a draft IRP Terms of Reference and a request for comments from stakeholders.

possible. If there are questions or you want to discuss, please let me know. Brian IRP Terms of Reference Consultation Appendix H Page 1 of 1 From: Stephen Thomas Sent: Wednesday, December 11, 2019 2:17 PM To: Godbout, Nicole Cc: Lefler, L...

AI summary The email discusses feedback on the draft Terms of Reference for the Integrated Resource Plan (IRP), expressing general support but raising concerns about the lack of formal participant status and stakeholder funding, which limits engagement from smaller stakeholders.

om established stakeholders with significant independent resources. For us, this is an issue to be discussed with UARB as well as yourselves, but it’s a major barrier in involvement from stakeholders. The overall level of transparency and...

AI summary The letter discusses concerns about stakeholder engagement and transparency in the Integrated Resource Planning (IRP) process. It highlights barriers to meaningful participation and requests discussion with the UARB. AREA provides feedback on the draft Terms of Reference for the IRP and emphasizes the need for a more reasonable timeline for stakeholder input.

of AREA’s position. We remain open to discussing such at NSPI’s earliest convenience so that AREA and NSPI can resolve the issues before the IRP’s official start to ensure a more streamlined process. • The Purpose states that this exercise...

AI summary The text outlines AREA's concerns with the Integrated Resource Planning (IRP) process, emphasizing the need to align objectives with least-cost strategies, address stakeholder concerns regarding time constraints, and ensure the process benefits ratepayers rather than NSPI. It highlights issues with the current assumptions and timeline for stakeholder engagement.

to challenge NSPI’s work, review that 3rd party’s results and then formulate a position. It is unreasonable to expect all of that stakeholder work can be completed within two weeks. Alternative Resource Energy Authority, c/o Town of Antigo...

AI summary The text discusses the need for sufficient time to review and challenge NSPI’s work, with comments on the pre-IRP report being reserved until further analysis can be conducted. The message is directed to Nova Scotia Power and includes several stakeholders involved in the process.

va Scotia Power 1223 Lower Water Street Halifax, NS B3J 3S8 Attn: Lindsay Musgrave December 12, 2019 Ms. Musgrave and the Nova Scotia Power IRP Team, Re: Comments on IRP Draft Terms of Reference Thank you for the opportunity to participate...

AI summary Nova Scotia Power provides comments on the 2020 Integrated Resource Plan Terms of Reference, emphasizing collaboration on climate goals, decarbonization, and electrification. They highlight the importance of aligning the IRP with HalifACT 2050 and working with municipalities to achieve emissions reductions and resiliency.

explore ways to cooperate with municipalities to advance resiliency and emissions reduction. In reviewing the evaluation criteria and process, I offer the following questions for your consideration: • Will the IRP address access to equitab...

AI summary The text discusses the need for the Integrated Resource Plan (IRP) to address equitable energy access and align with HalifACT 2050 objectives. It raises questions about validation of assumptions and collaboration with stakeholders such as the Halifax Regional Municipality (HRM) to advance climate action.

Natural Forces Services Inc. 1801 Hollis Street Suite 1205 Halifax NS B3J 3N4 T: (902) 422 9663 F: (902) 422 9780 Doreen Friis January 6, 2020 Regulatory Affairs Officer/Clerk Nova Scotia Utility and Review Board 1601 Lower Water Street, 3...

AI summary A letter from Natural Forces Services Inc. to the Nova Scotia Utility and Review Board regarding the 2020 Integrated Resource Plan Terms of Reference. The document does not include specific arguments or claims but references the regulatory process.

implicit in the exercise of creating “signposts”, but we believe it would be helpful in making it explicit. Such clarity is particularly important given the lengthy time frame of the Plan – 25 years. …2 We would also note that by explicitl...

AI summary The text advocates for explicitly modeling energy resources at economic prices in the Integrated Resource Plan (IRP) to better assess their systemic value, including capacity from offshore wind, predictability from tidal, scalability from solar PV, and flexibility from storage and demand management. The analysis emphasizes clarity over a 25-year planning horizon.

PO Box 910 ● Halifax, Nova Scotia ● Canada ● B3J 2W5 January 17, 2020 Doreen Friis Regulatory Affairs Officer/Clerk Nova Scotia Utility and Review Board 1601 Lower Water Street, 3rd Floor P.O. Box 1692, Unit “M” Halifax, NS B3J 3S3 Re: M08...

AI summary NS Power submitted draft Terms of Reference (TOR) for its 2020 Integrated Resource Plan (IRP) to the Nova Scotia Utility and Review Board (NSUARB). The filing incorporated feedback from stakeholders, including the Small Business Advocate (SBA) and Envigour Policy Consulting Inc. (on behalf of Natural Forces, QUEST, and Marine Renewables Canada). The SBA and Envigour expressed general support for the TOR, with no further comments from the SBA.

n (adjusted for end-effects). NS Power will continue to use this primary metric to guide resource planning, and will also assess others of increasing importance, including: • Magnitude and timing of electricity rate effects; • Reliability...

AI summary NS Power outlines its approach to resource planning using metrics like rate effects, reliability, grid services, and emissions reduction. An Analysis Plan will evaluate IRP modeling scenarios with alternative futures, employing modeling tools to assess operational feasibility and produce least-cost resource portfolios.

ting units). These portfolios will be evaluated for operational feasibility using appropriate electricity system modeling tools, and iterative analysis will be conducted as required. Natural Forces’ comment recognizes and reflects that giv...

AI summary The document discusses the evaluation of portfolios using electricity system modeling tools within the IRP process. Natural Forces emphasizes the need for broader criteria in dynamic energy environments, while NS Power prioritizes minimizing long-term cumulative revenue requirement. Envigour suggests incorporating uncertainty around technology price declines in resource plans.

d Energy Resources such as EV’s, Demand Management and Storage. We recognize that the Strategy, Roadmap and Action Plan are to include Page 3 of 4 January 17, 2020 D. Friis “consideration of “signposts” to monitor, future decision gates, a...

AI summary The text discusses NS Power's response to stakeholder feedback on incorporating economic models for EVs, demand management, and storage into their Strategy. NS Power agrees with the need for 'signposts' to monitor technology costs but does not support amending the TOR. They emphasize ongoing stakeholder engagement during the IRP process and confirm minimal, uncontroversial feedback from parties.

ve and uncontroversial. NS Power looks forward to continuing this engagement as it moves forward with the formal IRP process in 2020. Yours truly, Niccole Godbout Director, Regulatory Affairs c. 2020 IRP Stakeholders Page 4 of 4

AI summary NS Power expresses commitment to engaging stakeholders in the 2020 Integrated Resource Plan (IRP) process, emphasizing collaboration as the process moves forward. The letter is signed by Niccole Godbout, Director of Regulatory Affairs.

May 22, 2020 Via Email Ms. Doreen Friis Regulatory Affairs Officer/Clerk Nova Scotia Utility and Review Board 1601 Lower Water Street, 3rd Floor Halifax, NS B3J 3S3 Dear Ms. Friis, Re: P-884 - M08929, NS Power’s Integrated Resource Plan On...

AI summary NS Power is providing a progress report on the Integrated Resource Plan project to the Nova Scotia Utility and Review Board, detailing completed work, stakeholder engagement, and upcoming steps to finalize the report by September 30, 2020.

th a progress report on work completed and stakeholder engagement to date, as well as a view of the steps to come to achieve completion of the Final Report for filing with the Board in September 2020. As the Board is aware, NS Power initia...

AI summary NS Power provided a progress report on the Integrated Resource Plan (IRP) process, including pre-IRP analyses and stakeholder engagement. A Final Pre-IRP Report was circulated in November 2019, and the Terms of Reference for the core IRP process were approved. Stakeholder feedback informed the Assumptions and Scenarios and Modeling Plan, finalized in March 2020.

m NS Power showing how stakeholder feedback was addressed. These are both also available on the IRP website, and a copy of these documents are attached as Appendix B and C. May 22, 2020 D. Friis Since finalization of the Assumptions and Sc...

AI summary Nova Scotia Power (NS Power) has been working on the Integrated Resource Plan (IRP) and has updated stakeholders on the progress of the Modeling phase. A virtual workshop was held, and feedback has been addressed. The release of Modeling Results has been delayed from June 5 to June 26, with a stakeholder workshop planned for early July.

1 IRP Update Appendix 1 Page 2 of 487

AI summary The document is an appendix from an Integrated Resource Plan (IRP) update, indicating it is part of a larger regulatory proceeding related to energy planning in Nova Scotia.

................................ 15 4. Conclusion ........................................................................................................................................... 16 2 IRP Update Appendix 1 Page 3 of 487 Nova Sco...

AI summary Nova Scotia Power was directed by the NSUARB to complete an Integrated Resource Plan (IRP) process by mid-2020, including pre-IRP analyses by July 31, 2019. The company engaged stakeholders on IRP fundamentals and shared initial results to support the 2020 IRP Terms of Reference.

d four “pre-IRP deliverables” developed to address the Board’s direction. On July 31, 2019 the Company circulated the four draft deliverables to parties who had expressed interest in the IRP process: 2. Supply Options 3. Renewables 4. Dema...

AI summary Nova Scotia Power developed four pre-IRP deliverables, including a capacity study, supply options study, stability study for renewables, and demand response assumptions. These were shared with interested parties in July 2019. NS Power engaged stakeholders throughout the process, presenting report summaries at Pre-IRP Technical Conferences.

tter to Nova Scotia Power re: IRP and Generation Utilization and Optimization (M08059), October 5 2018 2 Attachment 2, Nova Scotia Power letter to NSUARB re: NS Power 2020 IRP and Pre-IRP Workshops 3 IRP Update Appendix 1 Page 4 of 487 Out...

AI summary Nova Scotia Power engaged with various stakeholders, including consultants and advocacy groups, during the development of its 2020 Integrated Resource Plan (IRP). Written feedback was requested following pre-IRP workshops, and responses to submissions were compiled in appendices and reports.

rt. Section 3 below provides NS Power’s response to these submissions; detailed technical responses to all individual questions and comments is also included in Appendix A and the Appendix A Addendum. As described in Section 3, NS Power is...

AI summary NS Power is responding to stakeholder submissions on the Pre-IRP Deliverables and plans to incorporate feedback into the broader IRP process. They have attached the final versions of the Pre-IRP Deliverables and will begin developing the Terms of Reference (TOR) for the IRP process, aiming for mid-2020 completion. Engagement activities included teleconferences, workshops, and one-on-one meetings.

h stakeholders to discuss questions and comments. The pre-IRP engagement activities are summarized in Figure 1 below. Figure 1: Pre-IRP 2019 Stakeholder Engagement Activities

AI summary The text mentions pre-IRP engagement activities and references Figure 1, which summarizes these activities. It highlights stakeholder discussions and the involvement of stakeholders in the process.

Date Stakeholder(s) Description Topics 24-May All IRP Interested Parties Teleconference Overview of Pre-IRP Deliverables One-on-one 13-Jun Ecology Action Centre General (Meeting) One-on-one 18-Jun EfficiencyOne General (Teleconference) One...

AI summary The text outlines a series of meetings and workshops related to the Integrated Resource Plan (IRP) involving various stakeholders such as the Ecology Action Centre, EfficiencyOne, CanWEA, and AREA. These sessions covered topics like IRP background, industry trends, capacity studies, and renewable energy integration.

ted Parties Workshop Study, Introduction to Stability Study for Renewables Integration Submission of 8-Aug AREA General Questions Submission of 8-Aug Envigour General Questions Submission of Renewable Power Cost source information for 21-A...

AI summary Various parties, including AREA, Envigour, and EfficiencyOne, submitted questions and participated in workshops and one-on-one meetings related to the Stability Study for Renewables Integration. The study's results were discussed in a workshop attended by all interested parties in the Integrated Resource Plan.

estions Results of Stability Study for Renewables Integration, 27-Aug All IRP Interested Parties Workshop Q&A on all Pre-IRP Deliverables Energy Futures Group Submission of 28-Aug General (E1 consultant) Questions One-on-one 3-Sep Verusche...

AI summary The text outlines a series of meetings and submissions related to the Integrated Resource Plan (IRP) process, including a workshop on the stability study for renewables integration and one-on-one meetings with various stakeholders.

5 IRP Update Appendix 1 Page 6 of 487 Bates White One-on-one 6-Sep General (Board Consultant) (Teleconference) Submission of 12-Sep AREA General Questions/Comments Submission of 12-Sep Bates White General Questions/Comments Submission of 1...

AI summary NS Power is engaging stakeholders throughout the Integrated Resource Plan (IRP) process, with responses to submissions and technical replies provided in the document. An IRP website has been launched to facilitate communication and gather feedback.

ication throughout this process, the Company has launched an IRP website (irp.nspower.ca) which it plans to use as repository for documentation as well as a tool for gathering stakeholder feedback. 6 IRP Update Appendix 1 Page 7 of 487 3....

AI summary NS Power has launched an IRP website to gather stakeholder feedback and provide transparency in the 2020 Integrated Resource Planning process. This is the fourth IRP process since 2007 and will use industry-leading modeling to evaluate resource portfolios for Nova Scotia’s energy future.

tions will be issued for stakeholder feedback, followed by revisions and issuance of Final Assumptions for use in the modeling. Figure 2: Phases of the IRP Process Terms of Reference Assumptions Development Scenario Development Analysis Pl...

AI summary The document outlines the Integrated Resource Plan (IRP) process, emphasizing the importance of evaluating options across various future scenarios due to significant uncertainty in planning areas. It highlights the need to identify signposts that may indicate changes in strategic direction and the evaluation of major assumption changes, particularly 'bookends' scenarios.

e portfolio modeling will be evaluating the impact of major changes in the underlying assumptions; in particular, the “bookends” (i.e. significantly high or low cases compared to the expected values). The Pre-IRP Deliverables provide start...

AI summary The text discusses the Pre-IRP deliverables and their role in setting base case assumptions for the Integrated Resource Plan (IRP). It highlights how early engagement and stakeholder feedback have improved the process compared to past IRP exercises. Some issues, like economic dispatch and contractual options, are deferred to later phases of the IRP.

constraints. The Analysis Plan may also identify other metrics for consideration in evaluating the optimal path forward that will be considered during the Modeling and/or Analysis/Conclusions Phases. Many of the remaining assumptions which...

AI summary The document outlines the development of an Analysis Plan for the Integrated Resource Plan (IRP), which includes modeling approaches, assumptions, and metrics for evaluating demand and supply-side resources. It also mentions a Capacity Study conducted by NS Power's consultant, Energy and Environmental Economics Inc (E3), focusing on statistical loss of load expectation (LOLE) studies to establish key assumptions for the IRP.

e the capacity requirements in the IRP modeling: 1) the planning reserve margin (PRM), and 2) the capacity contribution of renewable resources, also known as Effective Load Carrying Capability (ELCC). Key findings of this study include: x...

AI summary The document discusses capacity requirements in the Integrated Resource Plan (IRP) modeling, focusing on the planning reserve margin (PRM) and the effective load carrying capability (ELCC) of renewable resources. It outlines the range of PRM required for the NS Power system and explains the impact of variable renewable resources on capacity value.

firm service customers arising from unit outages, higher than anticipated system peaks or other system contingencies. Figure 5: Illustration of the Planning Reserve Margin 10 IRP Update Appendix 1 Page 11 of 487 NS Power has historically u...

AI summary NS Power has historically used a 20% PRM in system planning, but recent E3 study findings suggest a range of 17.8% to 21% for Nova Scotia's current resource mix. NS Power will use this data to propose a PRM for the IRP modeling. A lower PRM does not necessarily result in lower system capacity or costs, as optimization models often retain more capacity due to additional benefits like emissions reduction and grid services.

take into account other factors such as access to economic energy, contribution to emissions reduction, and essential grid services (e.g. inertia, ramping, voltage support, frequency response, etc.). These other benefits will often outweig...

AI summary The text discusses the importance of considering factors beyond economic optimization when determining system capacity, such as emissions reduction and grid services. It highlights that excess capacity may be necessary for grid reliability and mentions the need to refine PRM calculations in the IRP based on resource mix changes.

g likely resource mix, NS Power will be able to establish a PRM value and/or methodology to use for system design for the coming years at the conclusion of the IRP. 3.2.2 Capacity Value of Renewables NS Power recognizes a key issue for con...

AI summary NS Power acknowledges the challenge of replacing firm capacity and grid services provided by coal units in Nova Scotia, particularly due to limited interconnection, lack of natural gas, and the mismatch between solar generation and winter peak demand. The Integrated Resource Plan (IRP) will address these issues and establish a PRM value or methodology for system design.

al method for calculating the capacity value or ELCC of renewables. The results of these ELCC calculations are included in the Capacity Study (Attachment 17). 3.3 Supply Options Study (Attachment 18) In the Supply Options Study, E3 has con...

AI summary The document discusses the method for calculating the capacity value or ELCC of renewables, and the Supply Options Study conducted by E3, which includes cost estimates for new bulk grid supply options and projections from NS Power for existing units. It also highlights the need to consider essential grid services in the IRP Modeling phase due to the increasing availability of renewable energy.

IRP Update Appendix 1 Page 13 of 487 Figure 6: Illustrative Example of Essential Grid Services 3.3.1 New Bulk Grid Supply Options NS Power has discussed the cost estimates for new utility scale supply options from E3’s Supply Options Study...

AI summary NS Power is updating its Integrated Resource Plan (IRP) by considering new bulk grid supply options and refining the base case based on stakeholder feedback. The document also discusses sustaining capital investment for existing resources, noting that minor adjustments are unlikely to significantly affect IRP results.

13 IRP Update Appendix 1 Page 14 of 487 Our focus for the IRP process will be to ensure we capture the bounds of all plausible outlooks on how much it may cost to retain the existing fleet, by establishing a reasonable “base case” for sust...

AI summary The focus of the IRP process is to evaluate the costs of retaining the existing fleet, including establishing a base case and a high sensitivity case for sustaining capital investment. The document also mentions the evaluation of potential coal unit retirements and the importance of stability studies for renewables integration.

will propose draft values for a “high” sensitivity case in the Assumptions Development phase and welcomes feedback on these assumptions. 3.4 Stability Study for Renewables Integration (Attachment 19) NS Power engaged a third-party expert,...

AI summary NS Power conducted a stability study to assess the integration of renewable energy, confirming that current wind capacity is manageable and identifying requirements for increasing wind/solar capacity. The study supports the Integrated Resource Plan (IRP) and outlines integration costs for future renewable scenarios.

m, based on the findings of the Stability Study, as illustrated in Figure 7 below. These integration costs will then be included in the Draft Assumptions for stakeholder consideration and feedback. 14 IRP Update Appendix 1 Page 15 of 487 F...

AI summary The text discusses the process for establishing wind and solar interconnection cost assumptions based on the Stability Study, noting that economic and contractual issues are addressed in the Draft Assumptions and IRP Modeling Phase. It also covers demand response assumptions, including proposed programs and collaboration between Efficiency One and NS Power.

e E1 and NS Power teams have been working together to review the DR programs and will continue to collaborate in order to refine the DR Programs to be proposed in the Assumptions Development Phase. 15 IRP Update Appendix 1 Page 16 of 487 4...

AI summary The document highlights the collaboration between E1 and NS Power to refine demand response (DR) programs during the Assumptions Development Phase of the 2020 Integrated Resource Plan (IRP). The IRP is described as a critical resource planning exercise due to the global push for carbon reduction and the potential for electrification in heating and transportation sectors.

ave the tools to execute this undertaking in a manner which is consistent with industry-leading IRP practices that will deliver a robust and cost- effective long-term electricity plan for Nova Scotia. To complete this work effectively and...

AI summary The document discusses the importance of aligning the Terms of Reference for the Integrated Resource Plan (IRP) with industry-leading practices to develop a robust, cost-effective long-term electricity plan for Nova Scotia. It emphasizes the need to distinguish between strategic and tactical elements in the planning process and highlights the value of stakeholder feedback in shaping the IRP.

-IRP Deliverable Page 1 of 4 Nova Scotia Utility and Review Board Mailing address Office PO Box 1692, Unit “M" 3rd Floor, 1601 Lower Water Street Halifax, Nova Scotia Halifax, Nova Scotia B3J 3P6 B3J3S3 1 855 442-4448 (toll-free) board@nov...

AI summary The Nova Scotia Utility and Review Board has completed its review of Synapse Energy Economics' final report in matter M08059 and concluded that an Integrated Resource Planning (IRP) analysis is needed. NS Power supports the nine recommendations in the report and does not believe additional process is necessary at this time.

ded in the Synapse final report, and stated: As noted below, NS Power does not believe that additional process with respect to the Synapse Report is necessary at this time. The “planning window” this analysis creates, combined with clarity...

AI summary NS Power does not believe additional process is needed regarding the Synapse Report at this time. The Synapse Report highlights that under certain conditions, the thermal fleet should be retained through 2030, but this is not a final determination on long-term utilization.

eet is indicated through 2030.1 And, NS Power also notes, properly, that these results do not reflect a “final determination as to the long-term utilization of these generation units”. However, the entirety of our analysis indicates that a...

AI summary The analysis suggests that retaining the entire thermal fleet through 2030 is economic only under the reference plan assumptions, but other scenarios show lower costs and earlier retirement of a second coal unit. The Synapse report recommends confirming energy efficiency costs and potential as part of the IRP process to ensure accurate input assumptions.

rces in the province (gas, oil, imports) and the IRP must fully reflect this resource option. [Note that EfficiencyOne has been directed to file a DSM Potential Study by July 31,2019.] 2. Determine costs and achievable potential for peak-l...

AI summary The document outlines several key tasks related to resource planning, including incorporating various energy sources into the Integrated Resource Plan, analyzing demand response costs, evaluating bulk-scale battery storage, and monitoring sustaining capital costs for the thermal fleet.

ng capital costs incurred a range of 6.5% to 10.4% of total NPVRR costs in our main scenarios. It is critical to continue to assess the pattern of these costs and project future costs. 5. Establish requirements to allow increased levels of...

AI summary The text discusses the need to assess capital costs related to wind integration, establish requirements for increased wind on the NSPI system, and enhance coordination among Maritime Provinces for reliability. It also mentions the importance of evaluating technical improvements and the role of battery storage in supporting system stability.

pacity and unit commitment requirements needed in association with the Tufts Cove thermal units, to allow appropriate parameterization in Plexos to enable possible economic retirement. 8. Identify candidates for the “next” coal retirement...

AI summary The text outlines several considerations for capacity and unit commitment requirements related to Tufts Cove thermal units, identifies candidates for coal retirement after Lingan 2, and emphasizes the need to monitor natural gas trends in the Maritimes. It also references the Bates White fuel audit report for inclusion in the first phase of the Integrated Resource Plan (IRP) process.

l gas price and availability trends in the Maritimes. In addition, the following items noted in the Bates White fuel audit report likely should be addressed during the first phase of the IRP process: • Continue to evaluate new and existing...

AI summary The document outlines key considerations for the Integrated Resource Plan (IRP) process, including evaluating wind resources, assessing coal unit replacement economics, analyzing capital investments at Trenton 6 and Point Tupper, and determining planning reserve margins. The Nova Scotia Utility and Review Board (NSUARB) directs NS Power to complete the IRP by mid-2020, with pre-IRP analyses to be completed by July 31, 2019.

ll of the above pre-IRP analyses by that same date. This will enable proceeding with timely confirmation of appropriate input assumptions for use in the modeling and analysis phase of the IRP process. Also, recognizing that the DSM Potenti...

AI summary The document outlines the completion of the generation utilization and optimization matter, with a focus on the Integrated Resource Plan (IRP) process. It mentions the need for pre-IRP analyses, stakeholder engagement, and the involvement of EfficiencyOne, Synapse, and others in the development of the DSM Potential Study.

ficer/Clerk Nova Scotia Utility and Review Board 1601 Lower Water Street, 3rd Floor P.O. Box 1692, Unit “M” Halifax, NS B3J 3S3 Re: NS Power 2020 Integrated Resource Plan (IRP) – Pre-IRP Workshops In its letter dated October 5, 2018, the B...

AI summary The Nova Scotia Utility and Review Board directed NS Power to complete an Integrated Resource Plan (IRP) by mid-2020, including pre-IRP analyses. These analyses involve studies on loss of load expectation, resource options assumptions, demand response resource assumptions, and transmission requirements for increased renewables.

d program cost and peak load impact. 4. Conducting study of transmission requirements for increased levels of renewables on the Nova Scotia system [related to Synapse recommendation #5, 6] The Company also anticipates that Synapse recommen...

AI summary NS Power is preparing for the Integrated Resource Plan (IRP) process by conducting studies on transmission requirements for increased renewables and engaging with stakeholders through workshops. Updates on pre-IRP deliverables are being shared with the Board, and a Webex conference and additional workshops are planned to discuss the IRP process and key issues.

any’s pre-IRP workshops, to [email protected], in order to better enable the Company to move forward with this engagement process. Yours truly, Nicole Godbout Director, Regulatory c. Judith Ferguson Mark Sidebottom Lia MacDonal...

AI summary The document outlines the Integrated Resource Plan (IRP) regulatory process, highlighting pre-IRP deliverables due by July 31, including a Capacity Study and other analyses, as part of the 2019-2020 IRP process.

2020 Deliverables 31 Final Report Capacity Study Terms of Reference Supply Options Analysis Plan 2 DELIVERABLES Study DR Assumptions Scenario Development Renewables Stability Assumptions Study Modeling Conclusion Report 3 ENGAGEMENT IRP Up...

AI summary NS Power has engaged E3, a San Francisco-based consultancy specializing in electricity economics, to assist with pre-IRP analysis and guide the utility through the IRP process.

» E3 consults extensively for utilities, developers, government agencies 2 DELIVERABLES and environmental groups on clean energy issues: • United Nations Deep Decarbonization Pathways Project • Planning for California’s climate and renewab...

AI summary E3 and PSC are engaged by NS Power for clean energy and transmission planning. E3 has worked on global clean energy projects, while PSC specializes in power system studies. NS Power is conducting a capacity study to assess reserve margins and storage requirements.

2 DELIVERABLES DELIVERABLE TYPE: Report STATUS: ON TRACK 2. Supply Options Study DESCRIPTION: Consultant study which estimates the initial and sustaining costs and performance of new bulk grid supply options and future trends. NSP study of...

AI summary The document outlines deliverables related to a Supply Options Study, Demand Response Assumptions, and a Renewables Stability Study as part of the Integrated Resource Plan (IRP) process. These deliverables include reports and modeling assumptions aimed at assessing grid supply options, demand response impacts, and transmission requirements for increased renewable energy integration.

STATUS: ON TRACK 3 ENGAGEMENT IRP Update Appendix 1 Page 28 of 487 6 Attachment 3 - Pre-IRP Deliverables Page 7 of 10 NSP Pre-IRP Deliverables 1 PROCESS Party Recommendation Expected Delivery 1. Confirm costs and achievable potential for i...

AI summary The document outlines NSP's pre-IRP deliverables, including studies on energy efficiency, demand response, battery storage, and thermal fleet capital costs. These deliverables are part of the Integrated Resource Plan (IRP) process.

& Capacity Study 4. Monitor, track and project sustaining capital costs for the thermal fleet. Supply Options Study 5. Establish requirements to allow increased levels of wind on NSPI system. … NSPI should Renewables Stability Synapse dete...

AI summary The text outlines a series of actions related to capacity studies, renewable energy integration, and regional collaboration. Key points include monitoring sustaining capital costs for thermal fleets, increasing wind energy on the NSPI system, and exploring coal retirement alternatives after Lingan 2.

ns 3 ENGAGEMENT IRP Update Appendix 1 Page 29 of 487 7 Attachment 3 - Pre-IRP Deliverables Page 8 of 10 NSP Pre-IRP Deliverables 1 PROCESS Party Recommendation Expected Delivery Continue to evaluate new and existing wind resources in order...

AI summary The document outlines pre-IRP deliverables related to evaluating wind resources and assessing the economics of replacing existing combustion turbine units with newer, faster-ramping generation units.

er type of fast ramping generation. Bates 2 DELIVERABLES White Determine the extent of any capital investment that may be required at Trenton 6 or the Point Supply Options Study Tupper Marine Terminal after the current supply of domestic c...

AI summary The text outlines deliverables for an Integrated Resource Plan (IRP) update, including a supply options study and capacity study to assess planning reserve margins. It also mentions proposed stakeholder sessions to discuss the IRP process and draft studies.

- NS Power System 101 Options Study 2 DELIVERABLES - Pre-IRP deliverables - Uncertainties in the update Planning Environment - Review Draft Capacity - Review of stakeholder - Industry & Customer Study sessions plan Trends to Consider - Pre...

AI summary The text outlines deliverables and planning activities related to the Integrated Resource Plan (IRP) update, including stakeholder sessions, industry trends, and uncertainties in the planning environment. It references a presentation by Zach Ming and Arne Olson from June 28, 2019.

IRP Update Appendix 1 Page 33 of 487 Attachment 4 - Pre-IRP Deliverables Page 2 of 34 Outline ¬ IRP Overview ¬ E3 Introduction ¬ Electricity Industry Trends in Long-Term Planning • Challenges in Other Jurisdictions ¬ Nova Scotia Power Syst...

AI summary The document outlines the Integrated Resource Plan (IRP) update and introduces E3, a consulting firm specializing in electricity economics. E3 provides services to utilities, developers, and government agencies, focusing on clean energy and holistic analysis of the electricity sector.

rehensive distribution system the groups and long-term GHG planning analysis Asset Valuation Planning Market Analysis Determines asset values from Develops and deploys proprietary Models wholesale energy markets multiple perspectives tools...

AI summary The text discusses asset valuation, long-term planning, and market analysis, emphasizing the use of proprietary tools and models to support resource planning and forecasting. It also highlights the integration of these analyses into broader market contexts.

market participants IRP Update Appendix 1 Page 36 of 487

AI summary The text references an IRP Update Appendix and mentions market participants, indicating a regulatory context involving energy planning and stakeholder involvement.

4 Attachment 4 - Pre-IRP Deliverables Page 5 of 34 E3 Experience in Resource Planning ¬ E3 has worked with a wide range of clients that are increasingly writing the script for the emerging clean energy transition to understand how to plan...

AI summary E3 has extensive experience in resource planning, having worked with various clients on Integrated Resource Plan (IRP) processes and clean energy transitions. They have assisted entities like the California PUC, Sacramento Municipal Utilities District, and Hawaiian Electric Company in developing plans to achieve deep decarbonization and renewable energy goals.

loped an unparalleled understanding of the role of storage within highly and deeply decarbonized renewable electricity systems IRP Update Appendix 1 Page 37 of 487 5 Attachment 4 - Pre-IRP Deliverables Page 6 of 34 Key E3 Staff Bios Arne O...

AI summary The text provides bios of key staff members from E3, including Arne Olson and Zach Ming, who are involved in resource planning and energy modeling. Their expertise relates to renewable energy, system operations, and electricity economics.

on until system demand is lower IRP Update Appendix 1 Page 44 of 487 12 Attachment 4 - Pre-IRP Deliverables Page 13 of 34 Retail Rate Structures ¬ Reforms to existing retail rate structures will be necessary to enable both electrification...

AI summary The text discusses the need for reforms to retail rate structures to support electrification and renewable energy. It outlines the basic anatomy of a resource plan, including energy and capacity needs, with a focus on the planning reserve margin in Nova Scotia, which is set at 20% above peak load.

IRP Update Appendix 1 Page 47 of 487 Source: NERC 15 Emergence of Integrated Attachment 4 - Pre-IRP Deliverables Page 16 of 34 Resource Planning ¬ The concept of integrated resource planning “IRP” emerged in the 1980’s, bringing a new suit...

AI summary The text discusses the emergence of integrated resource planning (IRP) in the 1980s, which introduced demand-side resources as planning options. It contrasts this with the traditional planning paradigm that focused on supply-side resources like baseload, intermediate, and peaker power plants, evaluating them based on fixed and variable costs.

vs. often do you drink coffee? IRP Update Appendix 1 Page 49 of 487 17 Attachment 4 - Pre-IRP Deliverables Page 18 of 34 New Trends in Resource Planning ¬ New constraints added to the optimization Optimal investment point: • Emission targe...

AI summary The document discusses new trends in resource planning, including the integration of emission targets, renewable energy, and storage into optimization models. It highlights the emergence of capacity expansion models that address the complexities of renewable energy and storage, with case studies from California and the Pacific Northwest.

the years experience a peak load higher than this and half lower) ¬ PRMs vary by utility but typically range from MW 12%-20+% depending on system characteristics PRM • Larger systems with more load and resource diversity Traditional can ge...

AI summary The text discusses Planning Reserve Margin (PRM) and its variation across different utility systems, noting that larger systems can maintain lower PRMs while islanded systems require higher PRMs. It also mentions the contribution of renewable and storage resources to PRM in the context of an Integrated Resource Plan (IRP) update.

20 Attachment 4 - Pre-IRP Deliverables Page 21 of 34 Renewable/Storage Contribution to PRM ¬ In systems with high penetrations of renewable energy and storage, utilities must still maintain acceptable reliability through a planning reserve...

AI summary This text discusses the importance of renewable energy and storage in contributing to the planning reserve margin (PRM) through effective load carrying capability (ELCC). ELCC measures how much of a perfect capacity can be replaced by renewables or storage while maintaining system reliability. Calculating ELCC requires complex models that account for the correlation and probability of production between load and renewables.

Peak Load Reduction (GW) 10 1 0 0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 0 6 12 18 Hour Installed Solar PV Capacity (GW) IRP Update Appendix 1 Page 54 of 487 22 Attachment 4 - Pre-IRP Deliverables Page 23 of 34 Putt...

AI summary The document discusses the Integrated Resource Plan (IRP) and its requirement to evaluate energy, capacity, and emission needs while constructing a least-cost portfolio of resources. It references an appendix and attachment related to the IRP update and pre-IRP deliverables.

resources that satisfy these constraints at least-cost IRP Update Appendix 1 Page 55 of 487 23 Attachment 4 - Pre-IRP Deliverables Page 24 of 34 Key Challenges for California ¬ Least-cost plan for achieving 2050 economy-wide goals of 80% G...

AI summary The text outlines key challenges in achieving long-term greenhouse gas (GHG) reduction targets, emphasizing the need for a least-cost approach that balances renewable energy, storage, and firm capacity. Natural gas is highlighted as a cost-effective source of firm capacity, while replacing it entirely with renewables and storage is deemed extremely costly.

29 Attachment 4 - Pre-IRP Deliverables Page 30 of 34 NSPI Load and Resources Load NSPI 10-Yr Outlook Firm Peak Load Net of DSM (MW) 2016 Target Reliability Standard 0.1 days/year Target PRM 20% Total Requirement (MW) 2,419 Resources Namepl...

AI summary This document provides a 10-year outlook on load and resources for NSPI, including firm peak load net of DSM, target reliability standard, and total requirement. It details various energy resources and their capacities, including coal, oil, natural gas, biomass, hydro, wind, solar, and imports.

3,179 2,499 IRP Update Appendix 1 Page 62 of 487 30 Attachment 4 - Pre-IRP Deliverables Page 31 of 34 Key Nova Scotia Challenges Portfolio Optimization Firm Capacity Determining the optimal Maintaining portfolio of renewable, Renewab adequ...

AI summary The document outlines key challenges in Nova Scotia's energy sector, focusing on portfolio optimization and maintaining firm capacity. It highlights the need to balance renewable, hydro, storage, thermal, and demand-side resources while addressing limitations and potential coal retirements.

limitations of non- cost portfolio reflects this Demand- Thermal thermal resources Side Firm Fuel Renewable Integration Ensuring firm fuel for Given the limited electric new thermal resources interconnections with natural gas neighboring j...

AI summary The text discusses challenges related to ensuring firm fuel for new thermal resources in Nova Scotia, particularly due to limited natural gas pipeline capacity and the need to maintain grid stability with higher renewable energy penetration. It also includes contact information for Energy and Environmental Economics, Inc. (E3).

IRP Update Appendix 1 Page 64 of 487 Arne Olson, Sr. Partner ([email protected]) Attachment 4 - Pre-IRP Deliverables Page 33 of 34 NSP PRE-IRP DELIVERABLES 1. Capacity Study DESCRIPTION: Consultant LOLE study which calculates the required Pl...

AI summary The document outlines three pre-IRP deliverables from NSP, including a capacity study, a supply options study, and demand response assumptions. These deliverables focus on capacity planning, supply options, and modeling assumptions for demand response programs.

DESCRIPTION: Draft modeling assumptions (cost and load impacts) for 1 to 3 specific DR programs. DELIVERABLE TYPE: Assumptions Deck STATUS: ON TRACK 4. Renewables Stability Study DESCRIPTION: Consultant report identifying transmission requ...

AI summary The document outlines pre-IRP deliverables, including a capacity study, supply options study, renewables stability study, and DR program assumptions development. These deliverables are part of the Integrated Resource Plan (IRP) process and are currently on track.

IRP Update Appendix 1 Page 69 of 487 Attachment 5 - Pre-IRP Deliverables Page 4 of 89 IRP PROCESS OVERVIEW UARB Pre-IRP JUL Core IRP Process resulting in mid Deliverables 31 Final Report 2020 Capacity Study Terms of Reference Supply Option...

AI summary This text outlines the Integrated Resource Plan (IRP) process, highlighting the pre-IRP deliverables and their role in shaping key IRP assumptions. It mentions the iterative process for incorporating stakeholder feedback into the deliverables or analysis plans.

s (in time to be finalized by the Assumptions Development phase), or to design appropriate Scenarios and/or Sensitivities in the Analysis Plan to capture sstakeholder feedback. •Revise & iterate •Draft Analysis Draft on deliverables Plan •...

AI summary The document discusses the development of the Integrated Resource Plan (IRP), emphasizing the need to revise and iterate on deliverables, incorporate stakeholder feedback, and address uncertainties in the planning environment, particularly around factors that need consideration for the IRP.

iscussed in the workshop on June 28, 2019, there are many additional factors in the planning environment at this time to consider for this IRP; in particular there is uncertainty around: Customer Provision of Cost and behaviour and Distrib...

AI summary The document outlines the need to consider various uncertainties in the planning environment for the Integrated Resource Plan (IRP), including environmental policy, grid reliability, distributed energy resources, and customer behavior trends. It emphasizes the development of an Analysis Plan to address these factors and engage stakeholders in further discussions.

changes will be part of further discussion through development of the TOR and Analysis plan. Analysis Plan For example: Assumptions • Should IRP objectives move beyond “least cost NPV Revenue Modeling Requirement”? • How do we consider dec...

AI summary The text discusses the development of an Analysis Plan and TOR for an Integrated Resource Plan (IRP), focusing on assumptions related to IRP objectives, decarbonization, and uncertainty. It also mentions essential grid and reliability services, particularly in the context of high renewable energy penetration.

critical for a stable, reliable grid – but not all resources Potential to Provide can provide them. IRP Update Appendix 1 Page 74 of 487 Attachment 5 - Pre-IRP Deliverables Page 9 of 89 WHY DO ESSENTIAL GRID The proportions of the SERVICES...

AI summary The text discusses the importance of essential grid services and how the cost distribution of different energy portfolios (conventional and renewable) affects the stability and reliability of the grid. It emphasizes the need to consider these factors when evaluating portfolio options.

IRP Update Appendix 1 Page 75 of 487 Attachment 5 - Pre-IRP Deliverables Page 10 of 89 CAPACITY STUDY: OVERVIEW & DISCUSSION IRP Update Appendix 1 Page 76 of 487 Attachment 5 - Pre-IRP Deliverables Page 11 of 89 Overview of PRM Study Nova...

AI summary This document outlines the objectives of the Planning Reserve Margin (PRM) study conducted by Nova Scotia Power Inc. (NSPI) as part of the integrated resource planning (IRP) process. The study involves updating assumptions, reviewing industry best practices, and analyzing the Effective Load Carrying Capability (ELCC) of various resources like wind, solar, storage, and demand response.

– Storage – Demand Response IRP Update Appendix 1 Page 78 of 487 11 Attachment 5 - Pre-IRP Deliverables Page 13 of 89 Planning Reserve Margin (PRM) ¬ Planning reserves are resources held by the utility above the forecasted median peak load...

AI summary The text discusses the concept of Planning Reserve Margin (PRM), which is a measure of the additional capacity a utility maintains above the forecasted median peak load to ensure reliability. PRM varies by utility and is typically between 12% and 20%, depending on system characteristics.

ty can MW generally maintain lower PRMs PRM • Islanded systems with limited interconnections and load and Traditional Generation resource diversity such as Hawaii must maintain a PRM Nameplate 1-in-2 Capacity around 40% Peak Step 1 Step 2...

AI summary The text discusses the Planning Reserve Margin (PRM) and its relevance to reliability standards, particularly in islanded systems with limited interconnections. It notes that systems like Hawaii must maintain a PRM of around 40% due to limited resource diversity and interconnections. The document also references the Integrated Resource Plan (IRP) and its appendices.

12 Attachment 5 - Pre-IRP Deliverables Page 14 of 89 Renewable/Storage Contribution to PRM ¬ In systems with high penetrations of renewable energy and storage, utilities must still maintain acceptable reliability through a planning reserve...

AI summary The text discusses the importance of renewable energy and storage in contributing to the planning reserve margin (PRM) through effective load carrying capability (ELCC). ELCC measures how much renewable or storage capacity can replace firm capacity while maintaining system reliability, with calculations requiring complex models.

Wind Solar Storage IRP Update Appendix 1 Page 80 of 487 13 Attachment Diminishing Marginal ELCC and 5 - Pre-IRP Deliverables Page 15 of 89 Diversity Benefits of Renewables/Storage ¬ The ELCC of renewables or storage depends on the other re...

AI summary The text discusses the concept of diminishing marginal ELCC (Effective Load Carrying Capability) and diversity benefits of renewable and storage resources. It highlights how the ELCC of renewables or storage depends on the other resources on the system and illustrates the diminishing marginal peak load impact of solar PV. It also notes that diversity benefits between resources can result in a portfolio's total contribution being more than the sum of individual parts.

Peak Load Reduction (GW) 10 1 0 0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 0 6 12 18 Hour Installed Solar PV Capacity (GW) IRP Update Appendix 1 Page 81 of 487 14 Attachment 5 - Pre-IRP Deliverables Page 16 of 89 Juri...

AI summary The text includes a chart showing peak load reduction across different hours and a section titled 'Overview of Jurisdictional Review' from an attachment related to pre-IRP deliverables. It references an IRP Update Appendix and mentions jurisdictional review processes.

IRP Update Appendix 1 Page 82 of 487 Attachment 5 - Pre-IRP Deliverables Page 17 of 89 Overview of Jurisdictional Review ¬ E3 conducted a review of reliability standards and planning practices mainly across several North American electric...

AI summary E3 conducted a review of reliability standards and planning practices across North American electric jurisdictions, concluding that NSPI aligns with industry best practices. The review focused on reliability metrics, planning practices, and PRM conventions, with NSPI planning to a 1-day-in-10 year standard or 0.1 days/yr loss of load expectation (LOLE).

or 0.1 days/yr loss of load expectation (LOLE) IRP Update Appendix 1 Page 83 of 487

AI summary The text references a loss of load expectation (LOLE) of 0.1 days per year, as part of an Integrated Resource Plan (IRP) update appendix. This metric is used to assess system reliability and planning reserve margins.

Ireland LOLH 8 hours/year total payments to generators (Net-CONE PRM) IRP Update Appendix 1 Page 84 of 487 17 Attachment 5 - Pre-IRP Deliverables Page 19 of 89

AI summary The text includes a table with data on LOLH (Loss of Load Hours) and references to an IRP (Integrated Resource Plan) Update Appendix and Attachment 5 - Pre-IRP Deliverables. These elements are related to energy planning and regulatory processes.

19 RECAP: E3’s Renewable Energy Deliverables Page 21 of 89 Attachment 5 - Pre-IRPCapacity Planning Model ¬ RECAP is a loss-of-load probability (LOLP) model used to test the resource sufficiency of electricity system portfolios • This study...

AI summary The RECAP model is a loss-of-load probability (LOLP) model used to assess the sufficiency of electricity system portfolios. It uses a 1-day-in-10-year standard (0.1 days/yr LOLE) to determine the target PRM. The methodology involves calculating hourly load, renewable profiles, available dispatchable generation, hydro dispatch, transmission availability, storage dispatch, demand response, and loss of load.

spatch Demand Calculate Loss of Load Response IRP Update Appendix 1 Page 88 of 487 21 Attachment 5 - Pre-IRP Deliverables Page 23 of 89 Inputs for Load and Renewable Profiles ¬ Actual historical NSPI hourly load from 2009 to 2018 ¬ Actual...

AI summary The document outlines the inputs and methods used for creating load and renewable energy profiles as part of the Integrated Resource Plan (IRP) update. Historical load and renewable data from various years are used, along with weather data and advanced modeling techniques like Monte Carlo day-matching and artificial neural networks.

minimum output, and daily maximum energy IRP Update Appendix 1 Page 91 of 487 24 Attachment 5 - Pre-IRP Deliverables Page 26 of 89 Hydro and Tidal Resources Maximum Minimum Other Constraints in Hydro Group Resource Name Capacity (MW) Capac...

AI summary The document provides details on hydro and tidal resources, including their maximum and minimum capacities, along with other constraints. It lists various hydro groups and their respective capacities, as well as tidal and other resources, contributing to a total capacity of 393 MW.

PRM ¬ Access to firm natural gas fuel supply during winter peak electricity events could be challenging to NSPI if new capacity is added which would further constrain gas pipeline import capacity ¬ Various options for firm fuel supply exis...

AI summary The document discusses challenges related to accessing firm natural gas fuel supply during winter peak electricity events, especially if new capacity is added, which could further constrain gas pipeline import capacity. It also outlines various options for firm fuel supply and mentions that more information will be provided as the Integrated Resource Plan (IRP) progresses. Reliability metrics such as Loss of Load Expectation (LOLE), Loss of Load Hours (LOLH), and Expected Unserved Energy (EUE) are presented for NSPI in 2020.

29 Load and Resource Balance Attachment 5 - Pre-IRP Deliverables Page 31 of 89 High Operating Reserve Requirement Case

AI summary This section discusses the High Operating Reserve Requirement Case, which is part of the Load and Resource Balance section in the Pre-IRP Deliverables. It outlines the need for maintaining a high level of operating reserve to ensure system reliability.

Load Firm Peak Load Net of DSM (MW) 2,070 Target Reliability Standard 0.1 days/year Target PRM 21.0% Total Requirement (MW) 2,504 Resource Nameplate Capacity (MW) Effective Capacity (MW) Effective Capacity (%) Coal 1,081 1,081 100% Oil 231...

AI summary The document presents a load and resource capacity analysis, showing a firm peak load of 2,070 MW after demand-side management (DSM). It outlines the target reliability standard and total requirement of 2,504 MW, with various resources contributing different percentages of effective capacity. The total supply is 2,470 MW, resulting in a deficit of 38 MW.

-38 IRP Update Appendix 1 Page 97 of 487 30 Attachment 5 - Pre-IRP Deliverables Page 32 of 89 Effective Load Carrying Capability (ELCC) ¬ ELCC measures the ability of dispatch-limited resources to contribute to planning reserve requirement...

AI summary The document discusses Effective Load Carrying Capability (ELCC), a metric used to assess how dispatch-limited resources contribute to reliability and planning reserve requirements. ELCC helps determine how much firm capacity can be displaced by renewable energy, storage, or demand response without compromising system reliability.

variable generation IRP Update Appendix 1 Page 98 of 487

AI summary The text refers to an IRP Update Appendix, indicating a discussion related to an Integrated Resource Plan. It does not contain specific arguments, entities, or topics discussed in detail.

31 Attachment 5 - Pre-IRP Deliverables Page 33 of 89 Effective Capacity of All Resources ¬ Dispatchable resources are by convention generally counted at their nameplate capacity in PRM accounting ¬ Due to forced outages, and “ELCC” equival...

AI summary The text discusses the effective capacity of various dispatchable and renewable energy resources, comparing their nameplate capacity with their effective capacity. It highlights that some resources, such as coal and oil, have lower effective capacities due to forced outages, while renewables like wind and solar have significantly lower effective capacities.

usands of • LOLP: Loss of Load Probability years of plausible load, renewable, hydro, • LOLE: Loss of Load Expectation and stochastic forced outage conditions • EUE: Expected Unserved Energy • ELCC: Effective Load-Carrying • Captures therm...

AI summary The text describes a model used for capacity planning, including metrics like LOLE, LOLP, EUE, and ELCC, which evaluate system reliability and renewable resource capacity. It also references the E3 RECAP model and an IRP Update Appendix.

43 Attachment 5 - Pre-IRP Deliverables Page 45 of 89 Backcasting Hourly Loads ¬ Developing a robust set of hourly load profiles that is representative of a broad distribution of possible weather conditions – particularly extreme events tha...

AI summary The text discusses the development of hourly load profiles using neural network regression based on historical load data and weather indicators, and the prediction of renewable output using historical samples. These methods are part of the Integrated Resource Plan (IRP) update process.

Aug 12, 1973 50,000 Daily Load 80,000 MWh 40,000 Previous-Day 27,000 MWh Renewable 30,000 Generation (MWh) 20,000 Probability Function Choices Inverse distance 10,000 Square inverse distance Previous Day Renewable Generation 0 Gaussian dis...

AI summary The text presents a graphical representation of daily and previous-day renewable generation and load data, including probability function choices such as inverse distance, square inverse distance, and Gaussian distance. It appears to be related to energy forecasting or resource planning.

70,000 75,000 80,000 85,000 90,000 Multivariate normal Today's Load (MWh) 1 Probability of ‫݁ܿ݊ܽݐݏ݅ܦ‬௜ sample i Where abs[loadAug 12 – loadi]/stderrload + = ௡ distancei = being selected 1 abs[renewAug 12 –renewi]/stderrrenew ෍ ‫݁ܿ݊ܽݐݏ݅ܦ‬௝...

AI summary The text discusses the synthesis of hourly wind and solar profiles as part of the Integrated Resource Plan (IRP) update. It includes probabilistic load and renewable generation data, using statistical measures such as standard errors and distance calculations.

45 Attachment 5 - Pre-IRP Deliverables Page 47 of 89 Synthesizing Hourly Wind/Solar Profiles ¬ To select a daily wind/solar profile, the model analyzes the load on the day as well as the previous 3+ days of wind/solar generation (with the...

AI summary The document describes methods for synthesizing hourly wind and solar generation profiles based on load and historical data, as well as calculating stochastic outages for dispatchable generation using forced outage rates, mean time to failure, and mean time to repair.

Large generator recovery Large generator failure Week 1 Week 2 Week 3 Week 4 IRP Update Appendix 1 Page 114 of 487 47 Attachment 5 - Pre-IRP Deliverables Page 49 of 89 Wind and Solar ELCC Wind Capacity (MW) ELCC (MW) Average ELCC Marginal...

AI summary The text presents data on the Effective Load Carrying Capability (ELCC) for wind and solar capacity, showing how ELCC increases with additional capacity but at a decreasing rate. This information is part of an appendix in a document related to the Integrated Resource Plan (IRP) update.

Marginal ELCC 1.7 0.08 4.7% 4.7% 25 0.08 0.3% 0.0% 50 0.08 0.2% 0.0% 100 0.08 0.1% 0.0% 150 0.08 0.1% 0.0% 200 0.08 0.0% 0.0% 400 0.08 0.0% 0.0% IRP Update Appendix 1 Page 115 of 487 48 Attachment 5 - Pre-IRP Deliverables Page 50 of 89 1 a...

AI summary The text presents data on the Effective Load Carrying Capability (ELCC) for different storage capacities, including marginal ELCC percentages for both 1-hr and 2-hr duration storage. The data highlights how ELCC and marginal ELCC percentages change with increasing storage capacity.

6% 2-hr Storage Capacity (MW) ELCC (MW) ELCC % Marginal ELCC% 10 9 90% 90% 50 33 65% 59% 100 57 57% 48% 150 71 47% 28% 200 82 41% 22% 400 108 27% 13% 600 130 22% 11% 1,000 170 17% 10% IRP Update Appendix 1 Page 116 of 487 49 Attachment 5 -...

AI summary The text presents data on the Effective Load Carrying Capability (ELCC) for different storage capacities (2-hr and 4-hr durations) in megawatts (MW), including percentages and marginal ELCC percentages. This information is part of an IRP Update Appendix and an Attachment related to Pre-IRP Deliverables.

2% 0% 400 6 2% 0% 500 6 1% 0% DR Capacity (MW) ELCC (MW) ELCC % Marginal ELCC% 25 13 52% 52% 50 24 48% 44% 100 32 32% 16% 200 32 16% 0% 300 32 11% 0% 400 32 8% 0% 500 32 6% 0% IRP Update Appendix 1 Page 118 of 487 51 Attachment 5 - Pre-IRP...

AI summary The text presents tables showing the relationship between DR capacity and ELCC (Effective Load Carrying Capability) values at different levels. As DR capacity increases, the percentage of ELCC contribution decreases, indicating diminishing returns for additional demand response capacity.

t of System Adequacy (PASA) module of PLEXOS IRP Update Appendix 1 Page 122 of 487 55 Attachment 5 - Pre-IRP Deliverables Page 57 of 89 SPP Reliability Metric(s) and Standard Reserve Margin Accounting – Resource ▪ LOLE: 0.1 days/year ▪ Net...

AI summary The document discusses system adequacy metrics, including LOLE and PRM, and outlines reserve margin accounting methods for both resource and load considerations. It references the use of the PASA module of PLEXOS and mentions GridView and SERVM for loss of load modeling.

56 Attachment 5 - Pre-IRP Deliverables Page 58 of 89 MISO Reliability Metric(s) and Standard Reserve Margin Accounting – Resource ▪ LOLE: 0.1 days/year ▪ UCAP: Capacity de-rated for forced outages ▪ ICAP: Installed capacity Reserve Margin...

AI summary The document discusses reliability metrics and reserve margin accounting for MISO and ERCOT, including LOLE, PRM, UCAP, and ICAP, as well as load modeling and reserve margin calculations for the Integrated Resource Plan (IRP).

58 Attachment 5 - Pre-IRP Deliverables Page 60 of 89 NYISO Reliability Metric(s) and Standard Reserve Margin Accounting – Resource ▪ LOLE: 0.1 days/year ▪ IRM based on installed nameplate capacity – UCAP requirement is based on capacity Re...

AI summary The text discusses reserve margin accounting and reliability metrics used by NYISO and ISO-NE, including LOLE, IRM, and methods for calculating reserve margins based on installed capacity and demand curves. It also references the Integrated Resource Plan (IRP) and related modeling tools like GE-MARS.

59 Attachment 5 - Pre-IRP Deliverables Page 61 of 89 ISO-NE Reliability Metric(s) and Standard Reserve Margin Accounting – Resource ▪ LOLE: Demand Curve ▪ Dispatchable resources counted at – 0.2 days/year installed nameplate capacity – 0.1...

AI summary The document discusses reliability metrics and reserve margin accounting practices, including LOLE thresholds, reserve margin percentages, and how different resources are counted. It references the Integrated Resource Plan (IRP) and mentions energy efficiency and behind-the-meter PV as factors in load modeling.

▪ Operating reserves are included IRP Update Appendix 1 Page 127 of 487 60 Attachment 5 - Pre-IRP Deliverables Page 62 of 89 PJM Reliability Metric(s) and Standard Reserve Margin Accounting – Resource ▪ LOLE: 0.1 events/year ▪ Dispatchable...

AI summary The text discusses reserve margin accounting and reliability metrics used by PJM and CAISO, including LOLE, IRM, and PRISM. It outlines how dispatchable units and renewable ICAP are calculated, as well as the use of probabilistic reliability models.

f Load Modeling ▪ Internal probabilistic modelling IRP Update Appendix 1 Page 131 of 487 64 Attachment 5 - Pre-IRP Deliverables Page 66 of 89 PacifiCorp Reliability Metric(s) and Standard Reserve Margin Accounting – Resource ▪ No explicit...

AI summary The document discusses PacifiCorp's approach to reserve margin accounting in its Integrated Resource Plan (IRP), including how different resources are counted and the selected planning reserve margin of 13% updated every two years.

tional Grid estimated LOLE during availability for each technology (e.g. CCGT 2017/2018 winter is 0.001 hours/year = 85%) of nameplate ▪ Standard is set based on economic optimum Reserve Margin Reserve Margin Accounting – Load ▪ No require...

AI summary The document discusses the calculation of LOLE (Loss of Load Expectation) during the 2017/2018 winter, estimating it at 0.001 hours/year. It also mentions the standard for reserve margin being based on economic optimum and the de-rated capacity margin monitored in 2021 and 2018. The document references the Integrated Resource Plan (IRP) and includes an attachment related to pre-IRP deliverables.

71 Attachment 5 - Pre-IRP Deliverables Page 73 of 89 References ¬ Ireland • https://www.semcommittee.com/sites/semcommittee.com/files/media-files/SEM-15-103%20CRM%20Decision%201_0.pdf • https://www.semcommittee.com/sites/semc/files/media-f...

AI summary The text includes references to documents related to capacity adequacy standards and generation capacity statements, as well as contact information for Energy and Environmental Economics, Inc. (E3) and a senior managing consultant, Zach Ming.

• The loss of the tie to New Brunswick is the most significant contingency FOR IRP impacting system stability and associated planning and operational actions. SCENARIOS • Other renewable enabling technologies such as large scale batteries...

AI summary The loss of the tie to New Brunswick is a major contingency impacting system stability. Alternative solutions like large-scale batteries and synchronous condensers can help manage inverter-based generation but do not fully eliminate reliability issues. The second tie may change the need for minimum online thermal units, and grid code revisions are seen as a potential solution for system stability.

more general way of quantifying & the minimum number of on line thermal unit requirement, however, OPERATIONS expanded study would be required to further define this for Nova Scotia. • Increased levels of inverter based generation is known...

AI summary The text outlines study recommendations for assessing system security levels and operational impacts of increased renewable generation in Nova Scotia. It highlights the need for further studies on power quality, system dispatch scenarios, and technical requirements, including the use of PSCAD software and grid code changes.

IRP Update Appendix 1 Page 150 of 487 Attachment 5 - Pre-IRP Deliverables Page 85 of 89 PRELIMINARY DR PROGRAM ASSUMPTIONS IRP Update Appendix 1 Page 151 of 487 Attachment 5 - Pre-IRP Deliverables Page 86 of 89 DR PROGRAM ASSUMPTIONS: INTR...

AI summary The document outlines preliminary assumptions for demand response (DR) programs, including peak shaving and participation scenarios, as part of the Integrated Resource Plan (IRP) update. NS Power and Efficiency One (E1) are working together to define these programs for further assessment.

e 4,000 Residential generator installation, Balance of battery participants, 2.5 $8M/MW Battery utility control for up to cost covered by 6.25 MW peak defined number of NSP and funding shaving potential system peak events where available 1...

AI summary The document outlines next steps for the Integrated Resource Plan (IRP) process, including soliciting feedback on Pre-IRP Deliverables, allowing for revisions before the Assumptions Development phase, and planning for the formal IRP kick-off with draft Terms of Reference. One-on-one or broader meetings are available for addressing further questions or feedback.

formal kick-off of IRP with draft Terms of Reference • Discussion/Addressing Questions: One-on-one or broader meetings to address further questions/feedback are available by request. • Stakeholder Feedback: • While IRP kickoff begins, NSP...

AI summary The document outlines the formal kick-off of the Integrated Resource Plan (IRP) process, including the Terms of Reference, stakeholder feedback mechanisms, and pre-IRP deliverables such as the Stability Study for Renewables Integration, Sustaining Capital Forecast, and Demand Response Program Assumptions.

Scenario Development Study Demand Response Analysis Plan Assumptions Stability Study for Assumptions Renewables Integration Modeling E1 Potential Study Analysis/Conclusions Report IRP Update Appendix 1 Page 158 of 487 Attachment 6 - Pre-IR...

AI summary The document outlines the integration of a stability study for renewables into the Integrated Resource Plan (IRP). NSP and consultants are developing a methodology to estimate integration costs of additional wind based on stability issues and potential solutions. This includes defining specific increments of wind capacity beyond 1000 MW and associated interconnection requirements for stakeholder review.

Additional IRP Update Appendix 1 Page 160 of 487 modeling? Attachment 6 - Pre-IRP Deliverables Page 6 of 14 SSRI: QUESTION & ANSWER • Why did the Stability Study for Renewables Integration (SSRI) stop at 1000 MW of wind in Nova Scotia? • H...

AI summary The document presents a series of questions and answers related to the Stability Study for Renewables Integration (SSRI) and the Integrated Resource Plan (IRP) update. Key topics include the study's limitations, the impact of the Maritime Link, and the sensitivity of results to resource type and location.

IRP Update Appendix 1 Page 162 of 487 Attachment 6 - Pre-IRP Deliverables Page 8 of 14 SUSTAINING CAPITAL FORECAST IRP Update Appendix 1 Page 163 of 487 Attachment 6 - Pre-IRP Deliverables Page 9 of 14 OVERVIEW • The Pre-IRP Work provided...

AI summary This document discusses the Pre-IRP Work, which includes preliminary cost projections for existing supply-side assets on the NS Power system. NS Power plans to provide detailed unit cost and operating assumptions during the Assumptions Development phase of the Integrated Resource Plan (IRP).

rograms as part of its DSM Potential Study. • The DR program assumptions are meant to be viewed as potential details of a few specific programs within the larger scope of DR considered by E1. • NSP will continue to discuss with E1 and stak...

AI summary The document outlines the assumptions for demand response (DR) programs as part of the DSM Potential Study, noting that DR program assumptions are considered potential details of specific programs within the broader scope of DR. NSP will continue to collaborate with E1 and stakeholders to define DR programs during the Assumptions Development and Modeling phases of the Integrated Resource Plan (IRP).

e 4,000 Residential generator installation, Balance of battery participants, 2.5 $8M/MW Battery utility control for up to cost covered by 6.25 MW peak defined number of NSP and funding shaving potential system peak events where available 1...

AI summary The text includes details about battery installation programs, customer behavior-based peak shifting through time-of-use rates, and references to the Integrated Resource Plan (IRP) update and pre-IRP deliverables. It also includes a letter from Bates White Economic Consulting to Nova Scotia Power Inc. regarding initial questions for Stakeholder Session #4.

LY :RXOGWKHDGGLWLRQDON9OLQHWR1HZ%UXQVZLFNKDYHDQ\LPSDFWRQWKHH[SHFWHG LPSDFWRIWKH0DULWLPH/LQNRSHUDWLQJLQIXOOZLWK0XVNUDW)DOOVDOVRRSHUDWLQJLQIXOO"  IRP Update Appendix 1 Page 173 of 487 Attachment 8 - Pre-IRP...

AI summary The text includes a series of questions related to the Integrated Resource Plan (IRP) update, including topics such as the impact of additional transmission lines, the development of scenarios by Power System Consultants (PSC), the consideration of wind penetration scenarios, reliability constraints, synthetic inertia potential, and the feasibility of virtual synchronous generators. The document also references existing asset capital data from Nova Scotia Power Inc. (NSPI).

IRP Update Appendix 1 Page 174 of 487 Attachment 8 - Pre-IRP Deliverables Page 3 of 3  L +RZZLOOWKHUHVXOWVRIWKH(('5SRWHQWLDOVWXG\EHLQFRUSRUDWHGLQWKH,53PRGHOLQJ" LL 'RWKHEDVHORZDQGKLJKVFHQDULRVH[DPLQHGLQWKH((...

AI summary The text presents a series of questions regarding the integration of ((/DR potential study results into the IRP modeling, the alignment of scenarios, the assessment of existing ((/DR programs, assumptions about new ((/DR programs, and details about residential HVAC fuel switching measures and market barriers. These questions are part of a regulatory proceeding.

QDFWXDOIXHOFRVWVIDFHGE\ 163,UHVLGHQWLDOFXVWRPHUV" YL :KDWDUHWKH³VLJQLILFDQWPDUNHWEDUULHUVWRFXVWRPHUDGRSWLRQ´RI+9$&IXHO VZLWFKLQJ" %$7(6:+,7(  3DJH IRP Update Appendix 1 Page 175 of 487 Attachment 9 -...

AI summary EfficiencyOne has raised several questions regarding the assumptions and methodologies used in the RECAP model by NS Power, including DR dispatch, solar profiles, transmission constraints, and effective capacity definitions, as part of the 2019 IRP prework.

th nameplate capacity (Slide 21). Effective capacity changes on slide 23. Please explain. How does RECAP account for the need to “recharge” energy storage capacity and potential loss of availability? Based on changes to weather patterns in...

AI summary The text includes questions about the RECAP model's assumptions, ELCC calculations, PRM and LOLE targets in the IRP, and the potential impact of new federal clean fuel standards on IRP modelling. These questions focus on technical aspects of energy planning and regulatory considerations.

tions be considered for the IRP modelling, assuming there are impacts to NS Power? (although not enacted, NSP should consider the impact of the regulations as drafted to its overall IRP sensitivities) Why is demand response not considered...

AI summary The text raises questions about the Integrated Resource Plan (IRP) modelling, demand response viability, renewable integration, and assumptions in DR and EV programs. It also inquires about the consideration of curtailment and Remedial Action Schemes in the Renewable Stability Study and the assumptions used for DSM and program costs.

IRP Update Appendix 1 Page 177 of 487 Attachment 9 - Pre-IRP Deliverables Page 3 of 3 Please provide detailed assumptions with sources for NSP’s DR program analysis. It may be beneficial to walk-through these assumptions in the next pre-IR...

AI summary The document requests detailed assumptions and sources for NSP’s DR program analysis, including EV forecasts, opt-out assumptions, attrition, recurring costs, and peak shaving calculations. It also asks about the quantification of peak shaving potential and program costs related to behavior-based peak shifting.

epresenting E1, Draft questions for NSP re IRP prework by E3 and PSC Capacity Study What process did E3 undertake to determine whether temperature was a significant driver of renewable production? What information can E3 provide about the...

AI summary The text includes questions related to the Integrated Resource Plan (IRP) process, focusing on factors influencing renewable energy production, loss of load events, and cost considerations for wind energy. It also asks about modeling assumptions and data used in the Capacity Study and Supply Options Study.

ce the value of the Nalcor/NS Power annual RFP process and how it could be used to help balance wind]. Implications from non-utility (behind the meter – across the meter) Distributed Energy Resources At least one utility in Nova Scotia (Be...

AI summary The text discusses the potential of a pilot program in Berwick, Nova Scotia, involving behind-the-meter distributed energy resources and their implications for the Integrated Resource Plan (IRP) process. It raises questions about how the IRP process will address the risks and benefits of such technologies and whether evidence on these matters can be introduced.

 
 
!
 "
-#)
#&
( 
#$$#&()" (-
(#
$&(  $(
"
( 
$&2 
+#& ' #$'
"
 ')'' #"1

"
"(  $( #"
#
'' #"
9>
#"
) )'(
;<:
5
;C1< 
&' #"7
( (
'
"
"'( 
"
#$&( "
"

#&

")!&
#
-&'1

 '
)"...

AI summary The text discusses the Integrated Resource Plan (IRP) and related deliverables, including the need for accurate forecasting and the importance of stakeholder engagement in the planning process. It highlights the role of the Nova Scotia Power Inc. (NSPI) in delivering the IRP and the significance of incorporating demand-side management and renewable energy resources into the plan.

IRP Update Appendix 1 Page 181 of 487 Attachment 12 - Pre-IRP Deliverables Page 2 of 4

AI summary The document provides an update on the Integrated Resource Plan (IRP) and includes an attachment detailing pre-IRP deliverables. It is part of a regulatory proceeding in Nova Scotia.

$ (-1

 "
( 
#'(
#
 ( #"
!(& 
'
#+
"
"

'-'(!/
( 
#'(
$&

'
 '#
#+1

 

,!$ 
&#!
# 
-  '
"
"'( 
$ (
#'(
$&

#
8B=1


( 
&$
&#!
(( !"(
</
' 
>A
#&
&$ 
#!...

AI summary The document discusses the Integrated Resource Plan (IRP) update, focusing on pre-IRP deliverables and the importance of accurate planning for energy resource assessment. It emphasizes the need for precise data and methodologies in forecasting and system adequacy assessments, including the use of probabilistic tools and system evaluation models.

IRP Update Appendix 1 Page 183 of 487 Attachment 12 - Pre-IRP Deliverables Page 4 of 4
  
 
"
 ( #"
(#
( 
# /
( 
&' )&"
"(&
'
( 
# #+ "
 ( #"
#!!"('4%)'( #"'0

• !"
'$#"'
)'(#!&
"...

AI summary The document discusses the Integrated Resource Plan (IRP) update and pre-IRP deliverables, including topics such as demand-side management, energy efficiency, and the planning reserve margin. It outlines the need for stakeholder engagement, regulatory compliance, and the evaluation of energy resources.

Don Regan; Meaghan Barkhouse; Godbout, Nicole; MacDonald, Lia; Dylan Heide Subject: RE: IRP Question Date: Thursday, August 8, 2019 11:02:14 AM Good morning Aaron, Confirming receipt of your email. I’m also copying Carly Currie as she’ll b...

AI summary Aaron Long is requesting data from Nova Scotia Power regarding peak system load and wind capacity factors over the past five years to compare with the Integrated Resource Plan (IRP) proposal. The request is part of an ongoing regulatory proceeding related to energy planning.

mail? Kind regards, IRP Update Appendix 1 Page 185 of 487 Attachment 13 - Pre-IRP Deliverables Page 2 of 2 Aaron Long, P.Eng., MSc, MBA Director of Business Services Alternative Resource Energy Authority 1-902-497-1447 aaron.long@municipal...

AI summary This document provides comments from Bates White on the pre-IRP deliverables and discussions to date. Bates White notes that not all prior questions and requests have been addressed, and therefore their comments are necessarily abbreviated. They appreciate NSPI's collaborative efforts and inclusion in the upcoming pre-IRP work.

VQHFHVVDU\WRDFFRPSOLVKEHIRUHWKH ,53SURFHVVFDQEHJLQLQFOXGLQJDGGUHVVLQJVWDNHKROGHUTXHVWLRQVDQGFRQFHUQVDQGORRNIRUZDUGWR ZRUNLQJZLWK163,WKH%RDUGDQGVWDNHKROGHUVLQWKLVZRUN :HEUHDNRXWRXUFRPPHQWVDFURVVHDFK...

AI summary The text outlines the necessary steps to be completed before the Integrated Resource Plan (IRP) process can begin, including addressing stakeholder questions and concerns, and working with Nova Scotia Power Inc. (NSPI), the Board, and stakeholders. It breaks down the five pre-IRP reports to be reviewed.

IRP Update Appendix 1 Page 187 of 487 Attachment 14 - Pre-IRP Deliverables Page 2 of 7  7KHSODQQLQJUHVHUYHPDUJLQ 350 QHFHVVDU\WRPDLQWDLQDJLYHQOHYHORIUHOLDELOLW\LVDIXQFWLRQRI DQXPEHURIUHVRXUFHDQGV\VWHPYDULDEOHVWKDW...

AI summary The document discusses the Planning Reserve Margin (PRM) and its role in maintaining system reliability as part of the Integrated Resource Plan (IRP) process. It suggests that a single PRM value may not be appropriate across different resource scenarios and recommends using more conservative PRM values. It also notes the need for clarity in the definition of 'operating reserves' under the Electricity Efficiency and Conservation Act (E3).

LRQVLQFRQGXFWLQJLWVDQDO\VLVDQGUHDFKLQJLWV FRQFOXVLRQVZLWKUHVHUYHW\SHVWKDWDUHUHTXLUHGE\1(5&13&&DQGZLWKWKRVHFDWHJRULHVRI RSHUDWLQJUHVHUYHVGLVFXVVHGLQRXU$XGLW5HSRUW 2QSDJHRI(¶V3ODQQLQJ5HVHUYH0DUJLQDQG...

AI summary The text discusses Nova Scotia Power Inc.'s (NSPI) approach to capacity investments, suggesting that building or maintaining excess capacity may be economically optimal despite the 20% Planning Reserve Margin (PRM) requirement. It also mentions the alignment of data provided by NSPI with the Budget and Forecasting (B&F) update process (M09288). The Integrated Resource Plan (IRP) process is highlighted as a focus on minimizing customer costs, including those from unnecessary long-term capacity investments.

RP Update Appendix 1 Page 188 of 487 Attachment 14 - Pre-IRP Deliverables Page 3 of 7  (OHFWULF/RDG&DUU\LQJ&DSDELOLW\ 7KH(VWXG\SUHVHQWV(OHFWULF/RDG&DUU\LQJ&DSDELOLW\ (/&& HVWLPDWHVIRUZLQGVRODUHQHUJ\ VWRUDJHDQGFRPEL...

AI summary The E3 study provides estimates of Electric Load Carrying Capacity (ELCC) for wind, solar, energy storage, and combinations of wind+storage and solar+storage. It is unclear whether these would correspond to five resource addition options in the IRP modeling or three options—wind, solar, and storage. The study also provides ELCC estimates for demand response (DR) resources, and a separate study by Efficiency One estimates volumes of achievable DR and energy efficiency potential. Bates White requests more detailed cost estimates for each new technology presented in the study.

UHFHLYH WKLVGDWD:LWKRXWLWZHZLOOQRWEHDEOHWRDGHTXDWHO\DVVHVVZKHWKHUDQ\RI(¶VFRVWHVWLPDWHV IRUDQ\RIWKHWHFKQRORJLHVFRQWDLQHGLQWKHVWXG\DUHUHDVRQDEOH x 2QVOLGH(LGHQWLILHV³)L[HGFRVWV´WKDWDUH³H[SHQGL...

AI summary The text discusses the importance of accurate cost estimates for technologies in the context of the Electricity Efficiency and Conservation Act (E3). It also addresses the need to reconcile fixed costs for maintaining generating capacity and the importance of considering different unit sizes and configurations in the Integrated Resource Plan (IRP) to address system reliability and capture economies of scale.

IRP Update Appendix 1 Page 189 of 487 Attachment 14 - Pre-IRP Deliverables Page 4 of 7  WKDQVPDOOHUXQLWV6RIRUH[DPSOHLID0:FDSDFLW\QHHGZHUHLGHQWLILHGDVLQJOH0: FRPELQHGF\FOHXQLWZRXOGEHPRUHFRVWHIIHFWLYHWKD...

AI summary The text discusses the cost-effectiveness of different capacity configurations, questions the assumptions used in the Integrated Resource Plan (IRP), and raises concerns about the accuracy and relevance of data used in the 2018 NR/Electricity Assessment (ATB) study. It also highlights discrepancies in capital cost estimates for energy storage and suggests considering longer-duration storage options.

86'&$'ZRXOGHTXDO &$'N:7KH UHDVRQIRUWKLVGHYLDWLRQLVQRWSURYLGHG x 163,VKRXOGFRQVLGHUPRGHOLQJORQJHUGXUDWLRQVWRUDJHRSWLRQV EH\RQGKRXUV  x 6LPLODUO\(VKRXOGSURYLGHIXUWKHUVXSSRUWIRULWVHVWLPDWHVRII...

AI summary The document highlights several issues with the Integrated Resource Plan (IRP), including the need for longer-duration storage options beyond 4 hours, the need for better support for future battery storage cost estimates, the inclusion of out-of-province pumped storage options, and the need for a more thorough analysis of coal-to-gas conversions. It also notes that no cost estimates were developed for incremental natural gas pipeline capacity.

HORSHGDQ\HVWLPDWHVIRU WKHFRVWRILQFUHPHQWDOILUPQDWXUDOJDVSLSHOLQHFDSDFLW\IRUWKH,537KLVLVDFULWLFDO DVVXPSWLRQWKDWVKRXOGEHGLVFXVVHGLQDGYDQFHRIWKH,53  163,¶V([LVWLQJ$VVHWV6XVWDLQLQJ&DSLWDO'DWD %DWHV:K...

AI summary The document discusses the need to evaluate the cost of incremental firm natural gas pipeline capacity for the Integrated Resource Plan (IRP). It raises concerns about Nova Scotia Power Inc. (NSPI)’s sustaining capital costs, including planned refurbishments and administrative overhead, and highlights the need to align these estimates with the Electricity Efficiency and Conservation Act (E3). The document also mentions the importance of considering underway or recently completed capital investments in the IRP process.

ERWKDSSURYHGE\WKH%RDUGDQGDOUHDG\H[SHQGHG±EHFRQVLGHUHGLQWKH,53SURFHVV±LHWKH\ VKRXOGEHWUHDWHGDVSRWHQWLDOO\DYRLGDEOH  (IILFLHQF\2QH(('56WXG\ LYHQ163,¶VHVWLPDWLRQWKDWLWIDFHVDQHDUWHUPFDSDFLW\GHILFLW...

AI summary The document discusses the need for Nova Scotia Power Inc. (NSPI) to evaluate the potential of energy efficiency (EE) and demand response (DR) programs in addressing short-term capacity deficits and deferring long-term investments in generation and transmission. It also recommends that NSPI explicitly evaluate and report on the potential of EE/DR to mitigate near-term capacity deficits and defer long-term investments.

(('5WRPLWLJDWHQHDU WHUPFDSDFLW\GHILFLWVDQGWRGLVSODFHORQJHUWHUPLQYHVWPHQWVLQH[LVWLQJDQGQHZVXSSO\UHVRXUFHV DVZHOODVWUDQVPLVVLRQ  36&5HQHZDEOH,QWHJUDWLRQ6WXG\ 7KH36&5HQHZDEOH,QWHJUDWLRQ6WXG\DSSHDUVWRSURY...

AI summary The document discusses the 365kV line addition to the Nova Scotia Power Inc. (NSPI) system and highlights the findings of the PSC Renewable Integration Study. The study does not set a volume limit for additional wind resources but recommends an expanded analysis to explore this question further. It also notes that adding a second 365kV line to New Brunswick (Onslow to Salsbury) would enhance the system's ability to accommodate at least 400MW of additional wind resources, but does not confirm that this addition is required or that 400MW represents a maximum incremental addition of wind. The study does not consider synthetic inertia potential via Virtual Synchronous Generators as an alternative to synchronous condensers.

\VWHPVWDELOLW\WKHUHLV LQFUHDVLQJUHFRJQLWLRQWKDWV\QWKHWLFDOWHUQDWLYHVFDQEHHIIHFWLYHDQGFRVWHIILFLHQW$Q\ H[SDQGHGDQDO\VLVVKRXOGHYDOXDWHVXFKDOWHUQDWLYHV x 7KHVWXG\DVVHUWVWKDW³>L@QWURGXFLQJODUJHUYROXPHVRISRZHU...

AI summary The text discusses the increasing recognition of synthetic alternatives as effective and cost-efficient, emphasizing the need for expanded analysis to evaluate such alternatives. It also highlights the importance of addressing potential grid code modifications and their implications, which were not adequately addressed in previous studies.

Attachment 16 - Pre-IRP Deliverables Page 1 of 2 Mila Milojevic Manager System Planning Nova Scotia Power Inc Delivered via email to [email protected] 13 September 2019 Re: Letter of Comment Regarding Current IRP Dear Mila, The Alt...

AI summary The Alternative Resource Energy Authority (AREA) commends Nova Scotia Power Inc. (NSPI) for its inclusive Integrated Resource Plan (IRP) process. AREA, representing three Nova Scotia towns, emphasizes the need for the IRP to explore alternative project financing structures to reduce renewable energy costs and support the province’s decarbonization goals.

ship. Based on our direct experience, capital is available at rates lower than typically associated with NSPI ownership and this will lead to reduced renewable energy generation and integration costs. Also based on our experience, the cost...

AI summary The Alternative Resource Energy Authority (AREA) submits comments on the Integrated Resource Plan (IRP), noting that capital is available at lower rates than NSPI ownership, which could reduce renewable energy costs. AREA also highlights that wind energy costs in Nova Scotia are lower than stated in reports and that existing sites have expansion potential. AREA requests further data on ELCC for renewables and acknowledges NSPI's efforts post-Hurricane Dorian.

IRP Update Appendix 1 Page 197 of 487 Attachment 16 - Pre-IRP Deliverables Page 2 of 2 Cc: Lia MacDonald, Senior Director Enterprise Asset Management, NSPI Carly Currie, Regulatory Project Manager, NSPI Nicole Godbout, Director of Regulato...

AI summary The document includes contact information for various officials and organizations related to the Integrated Resource Plan (IRP) update and a deliverable titled 'Planning Reserve Margin and Capacity Value Study' prepared by Nova Scotia Power Inc. in July 2019.

Attachment 17 - Pre-IRP Deliverables Page 3 of 85 Planning Reserve Margin and Capacity Value Study July 2019 © 2019 Copyright. All Rights Reserved. Energy and Environmental Economics, Inc. 44 Montgomery Street, Suite 1500 San Francisco, CA...

AI summary This document outlines the Planning Reserve Margin and Capacity Value Study conducted in July 2019 by Energy and Environmental Economics, Inc. It is part of the Integrated Resource Plan (IRP) update process and includes pre-IRP deliverables. The study focuses on energy planning and system reliability.

Attachment 17 - Pre-IRP Deliverables Page 7 of 85 Executive Summary Acronyms DAFOR Derated Adjusted Forced Outage Rate DR Demand Response EE Energy Efficiency ELCC Effective Load Carrying Capability EUE Expected Unserved Energy FOR Forced...

AI summary This study updates planning assumptions for Nova Scotia Power Inc. (NSPI) to ensure resource adequacy in its integrated resource planning (IRP) process, supporting the delivery of reliable and affordable power to customers.

er estimate of operating reserve requirements for the NSPI system. Target PRM 17.8% - 21.0% This study finds that the dispatch-limited resources wind, solar, storage, and demand response can contribute effective load carrying capability (E...

AI summary This study updates planning assumptions for Nova Scotia Power Inc. (NSPI) in the integrated resource planning (IRP) process, focusing on the planning reserve margin (PRM) and the effective load carrying capability (ELCC) of dispatch-limited resources such as wind, solar, storage, and demand response.

mate the ELCC in a simpler but less accurate manner. ELCC is calculated via the following procedures, assuming that the utility uses an LOLE reliability standard: 1. Calculate base system LOLE 2. Add variable resource(s) to the system and...

AI summary The text explains the calculation of Effective Load Carrying Capability (ELCC) using the Loss-of-Load Expectation (LOLE) reliability standard. It outlines the steps to calculate ELCC by adjusting the system's load and resource availability, emphasizing the impact of diversity and diminishing returns on the ELCC of a resource.

pendix 1 Page 223 of 487 Attachment 17 - Pre-IRP Deliverables Page 26 of 85 Planning Reserve Margin and Capacity Value Study

AI summary The document discusses the Planning Reserve Margin and Capacity Value Study, which is part of the pre-Integrated Resource Plan (IRP) deliverables. This study is critical for assessing the adequacy of generation capacity and ensuring system reliability.

nd Capacity Value Study As described in Section 1.1, this study provides an update of the required PRM and confirms that a PRM of at least 20% is necessary to meet a target LOLE of 0.1 days/year. As a vertically integrated utility, NSPI is...

AI summary This study updates the required Planning Reserve Margin (PRM) to ensure a target Loss of Load Events (LOLE) of 0.1 days per year. Nova Scotia Power Inc. (NSPI) is responsible for developing an Integrated Resource Plan (IRP) that meets system needs, including the PRM, and submitting it to the Nova Scotia Utility and Review Board (UARB). The study uses E3’s Renewable Energy Capacity Planning (RECAP) model to assess resource adequacy.

Steps In order to perform each step in the model listed above, RECAP requires data on the characteristics of loads and the resources available to serve those loads which are listed in Table 4. © 2018 Energy and Environmental Economics, Inc...

AI summary The document outlines the data requirements for RECAP, which is used in the Planning Reserve Margin and Capacity Value Study. It mentions that data on load characteristics and available resources are needed to perform the steps in the model.

IRP Deliverables Page 36 of 85 Planning Reserve Margin and Capacity Value Study Table 4: RECAP Data Requirements Category Metric

AI summary The document discusses the Planning Reserve Margin and Capacity Value Study, focusing on the RECAP Data Requirements outlined in Table 4. It highlights the need for specific metrics across different categories to support integrated resource planning.

Forced outage rate (FOR) Maximum capacity Demand Response Maximum # of calls per week/month/year Maximum duration of each call Zonal representation of electric system Transmission Maximum transmission capacity between zones Forced outage r...

AI summary The document discusses the methodology of the RECAP model, which is used to simulate the electric power system over multiple years using historical weather data and extended load and renewable profiles. It highlights the challenge of developing accurate hourly load profiles that account for extreme weather events.

sk of loss of load – is a challenge for reliability modelers, as actual load shapes from recent historical years may not be representative of the long-run distribution of such extreme weather events. To overcome this challenge, E3 develops...

AI summary This text discusses the challenge of modeling load under extreme weather events and describes E3's method of using a neural network regression to develop hourly load profiles based on historical data and weather indicators. The approach involves using temperature, month, day-type, and economic growth factors to predict load behavior over long time horizons.

ord with the same day-type (weekday/weekend/holiday), is within +/- 15 calendar days, and has the closest total daily load. An example result of this neural network process is shown in Figure 11. 26 P a g e IRP Update Appendix 1 Page 236 o...

AI summary The document discusses the use of a neural network process to backcast hourly load data, emphasizing the importance of a large dataset to assess load uncertainty. It also outlines the Monte-Carlo approach used by E3 to extend renewable generation data over the entire weather record while maintaining correlations between load and renewable production.

lling basis using a day matching algorithm that considers both the daily load and the level of wind/solar generation in the preceding days, with the most recent days being weighted the most highly. © 2018 Energy and Environmental Economics...

AI summary The document describes an algorithm used to create synthetic load-renewable pairings by searching through historical load and renewable generation data to find days similar to a specific day of interest, with the most recent days being weighted more highly.

ons are also captured that are dependent upon the specific system in question. An illustration of the correlations that are still captured as the model extends the wind/solar record is shown below. © 2018 Energy and Environmental Economics...

AI summary The document discusses how hydro resources are modeled in RECAP, distinguishing between dispatchable and non-dispatchable hydro resources. Tidal resources are modeled similarly to variable resources like wind and solar.

Appendix A - Pre-IRP Deliverables Page 4 of 29 commercial/contract for firm capacity be in place and that it can be delivered via firm transmission.

AI summary The document discusses the requirement for a commercial/contract for firm capacity to be in place and deliverable via firm transmission, likely in the context of integrated resource planning (IRP) deliverables.

Party Question/Comment & Response 5.1 Bates White Please explain the components of each year’s sustaining capital cost. As discussed in Section 3.3.2, the annual 10 Year System Outlook Report IRP Update Appendix 1 Page 458 of 487 Appendix...

AI summary Bates White inquires about the components of each year’s sustaining capital cost. NSP explains that the sustaining capital forecast is developed based on the condition of unit assets and their expected utilization, as outlined in the 10 Year System Outlook Report. The forecast is broken down by asset class, and changes in assumptions can affect the sustaining capital requirements.

IRP Update Appendix 1 Page 462 of 487 Appendix A - Pre-IRP Deliverables Page 21 of 29

AI summary The text references an Integrated Resource Plan (IRP) update and an appendix containing pre-IRP deliverables, indicating a regulatory process related to energy planning and resource management.

Party Question/Comment & Response 7.1 Bates White How will the results of the EE/DR potential study be incorporated in the IRP modeling? The EE/DR assumptions and scenarios, as well as plan for incorporating in the model, will be establish...

AI summary Bates White questions how the results of the EE/DR potential study will be incorporated into the IRP modeling, whether the study's scenarios align with those used in the IRP, and whether the study evaluated NSPI's existing EE/DR programs. NSPI responds that the EE/DR assumptions will be developed during the IRP process and that additional programs may be considered during the Assumptions Development phase.

Appendix A: Energy + Environmental Economics (E3), Deep Decarbonization in Nova Scotia: Phase 1 Report Appendix B: IRP Assumptions Appendix C: IRP Scenarios & Modeling Plan Appendix D: IRP Relative Rate Effect Model Appendix E: IRP Modelin...

AI summary The document outlines various appendices related to an integrated resource plan (IRP) for Nova Scotia, including modeling assumptions, scenarios, rate effect models, and stakeholder engagement materials. It includes findings, action plans, and responses to previous directives.

1IRP SUMMARY

AI summary The document is a placeholder heading for an Integrated Resource Plan (IRP) summary, referencing Energy + Environmental Economics (E3). No substantive content is provided in the text chunk.

1.1 Introduction In the 2020 Integrated Resource Plan (IRP), Nova Scotia Power puts forward a long-term strategy for delivering safe, reliable, affordable and clean electricity to customers across Nova Scotia. At its core, the plan illustr...

AI summary Nova Scotia Power's 2020 Integrated Resource Plan (IRP) outlines a strategy for clean, reliable, and affordable electricity aligned with provincial decarbonization goals under the Sustainable Development Goals Act (SDGA). The plan emphasizes stakeholder engagement, electrification of sectors like transportation, and near-term actions to transition to a decarbonized grid, supported by collaborative input from workshops and consultations.

1.2 Nova Scotia Power's System Transformation This IRP represents a blueprint for a significant transformation in the way Nova Scotia Power generates and purchases electricity to serve its customers across the province. The scenarios consi...

AI summary Nova Scotia Power's Integrated Resource Plan (IRP) outlines a strategy to accelerate greenhouse gas emission reductions, aligning with climate goals. The plan emphasizes technological innovation, rate stability, and the role of aging hydro facilities like Wreck Cove, now critical for integrating variable renewable energy.

1.3 Evolving Planning Landscape Electric utilities today must navigate a rapidly changing and uncertain resource planning environment, driven by decarbonization goals, regulatory and policy developments, new technologies with uncertain fut...

AI summary Electric utilities face uncertainty in resource planning due to decarbonization goals, regulatory changes, and new technologies. Nova Scotia Power has addressed these challenges through various planning scenarios, aligning with the SDGA's emission reduction targets, including a 38% reduction below 2005 levels by 2019 and commitments to coal unit retirements.

1.4 Planning Objectives Through the IRP process, Nova Scotia Power undertakes long-term system planning to understand how the electricity system will continue to meet the needs of customers and respond to changes in the electricity plannin...

AI summary Nova Scotia Power uses the Integrated Resource Plan (IRP) process for 25-year system planning to ensure safety, reliability, affordability, and cleanliness. Near-term 'no-regrets' actions are prioritized to align with long-term objectives, addressing future uncertainties while maintaining customer interests.

1.5 The IRP Planning Process Nova Scotia Power's 2020 IRP reflects a detailed effort over more than a year to create an electricity strategy for the future. In consultation with stakeholders, Nova Scotia Power has produced several interim...

AI summary Nova Scotia Power's 2020 Integrated Resource Plan (IRP) involved extensive stakeholder consultation and iterative planning, producing interim documents and an Action Plan/Roadmap. The IRP serves as a flexible, long-term directional guide for resource strategies, emphasizing transparency, stakeholder input, and adaptive decision-making to meet future electricity needs.

1.6 Exploring a Diverse Set of Scenarios Nova Scotia Power undertook an initial scenario development exercise with stakeholders to solicit input on an appropriate range of scenarios to be considered through the IRP exercise. From there, us...

AI summary Nova Scotia Power developed scenarios with stakeholders for its Integrated Resource Plan (IRP), considering coal plant retirement timelines (2030 vs. 2040) and evaluating trade-offs under different conditions to ensure robust long-term planning aligned with net-zero goals.

1.7 Developing Optimal Resource Plans Nova Scotia Power assessed each scenario by optimizing its resource portfolio and operations using a suite of analytical planning models. Through consultation with stakeholders, and input from the Ener...

AI summary Nova Scotia Power develops optimal resource plans by using analytical models and stakeholder input to assess various technologies. The process considers capital and operating costs, system reliability, and environmental targets to identify the lowest-cost solutions that meet long-term objectives.

ources identified in this IRP, incremental greenhouse gas savings will grow. Across the scenarios, the greenhouse gas reduction achieved by switching to a heat pump increases to 87-95 percent by 2045. The trend for electric vehicles is sim...

AI summary Nova Scotia Power's IRP projects significant GHG reductions (87-95% by 2045) through heat pumps and EVs, aligning with SDGA net-zero goals. Electrification reduces rate pressures while enabling decarbonization. Comparator scenarios fail to meet SDGA targets.

1.9 Overview of Action Plan and Roadmap The Action Plan is a key output of the 2020 IRP. As described in the 2020 IRP Terms of Reference, the Action Plan identifies the critical undertakings required over the near term to implement the lon...

AI summary The Action Plan, derived from the 2020 Integrated Resource Plan (IRP), outlines near-term strategies to implement Nova Scotia's long-term electricity strategy. Nova Scotia Power emphasizes balancing immediate planning objectives with flexibility to adapt to future opportunities.

1.9.1 Action Plan The Action Plan includes insights and ranges informed by the model outputs and findings, as analyzed across the scenarios. These will continue to be reviewed and updated, and should be understood in terms of their orders...

AI summary The Action Plan outlines a Regional Integration Strategy to enhance Nova Scotia's energy reliability and access to low carbon energy, including the development of a Reliability Tie and Regional Interconnection. Electrification is highlighted as a key variable in the Integrated Resource Plan, supporting provincial decarbonization goals.

1.9.2 Roadmap As conditions change – either through changes to policy, technology, or economics – Nova Scotia Power will adapt its resource plan to best serve customers. The Roadmap sets out a series of signposts that, if observed, may ind...

AI summary Nova Scotia Power will adapt its resource plan based on policy, technology, and economic changes. Key actions include advancing coal-to-gas studies, conducting system stability analyses with wind integration, and evaluating hydro and thermal unit investments while monitoring for deviations from the Integrated Resource Plan (IRP) assumptions.

1.10 Going Forward Nova Scotia Power's 2020 IRP reflects global themes of transformation, economy-wide decarbonization, adoption of green technologies, and collaboration with a broad range of stakeholders. Interest in these themes has been...

AI summary Nova Scotia Power's 2020 Integrated Resource Plan (IRP) emphasizes global themes such as decarbonization, green technology adoption, and stakeholder collaboration, influenced by the COVID-19 pandemic and economic recovery efforts. The IRP reflects a commitment to long-term clean energy planning and affordability, with ongoing stakeholder engagement playing a key role in achieving sustainability goals.

2.1 Nova Scotia Power's Mission Delivering safe, reliable, affordable, and clean energy is central to Nova Scotia Power's mission. This Integrated Resource Plan (IRP) represents Nova Scotia Power's first long-term plan that commits to the...

AI summary Nova Scotia Power's mission focuses on delivering safe, reliable, affordable, and clean energy. The Integrated Resource Plan (IRP) commits to retiring all coal units within the planning horizon, aligning with customer preferences, provincial goals, and the need for deep decarbonization to mitigate climate change impacts.

2.2 Objectives of the IRP As a regulated utility with an obligation to serve customers, planning for the future is a responsibility and requirement for Nova Scotia Power. The IRP is a long-term planning exercise that establishes the direct...

AI summary Nova Scotia Power's Integrated Resource Plan (IRP) outlines long-term objectives focused on developing a robust, risk-weighted, lowest-cost electricity strategy that ensures safe, reliable, and affordable energy delivery while supporting provincial decarbonization. The IRP also includes an Action Plan and Roadmap for implementation and emphasizes collaborative, transparent planning processes with stakeholder engagement.

2.3 Process for the IRP Prior to initiating the core IRP process, Nova Scotia Power undertook a number of pre-IRP studies per the recommendations of the Generation Utilization and Optimization Report10 (completed by the Nova Scotia Utility...

AI summary Nova Scotia Power conducted pre-IRP studies, including a PRM and Capacity Study, Resource Options Study, and Demand Response Options Study, based on recommendations from prior reports. Stakeholder engagement was carried out in 2019, and a Final Pre-IRP Report was issued in October 2019. The IRP modeling process followed a detailed Terms of Reference with stakeholder workshops between modeling stages.

2.4 Advancements in the IRP Approach The evolving planning landscape described above, coupled with advancements in modeling and utility planning best practices, has allowed Nova Scotia Power to update and improve upon its long-term resourc...

AI summary Nova Scotia Power has updated its Integrated Resource Plan (IRP) approach to account for increased uncertainties and changes in the electricity industry. The new approach considers factors beyond the lowest cost resource mix, including environmental requirements, government policy, reliability, grid stability, and customer rate impacts.

2.4.1 Multiple NPVRR and Rate Metrics Traditionally, the objective for resource planners has been to model and identify an optimal portfolio of resources that minimize cost Net Present Value of Revenue Requirement (NPVRR) as the sole metri...

AI summary The Integrated Resource Plan (IRP) has moved beyond traditional cost-based Net Present Value of Revenue Requirement (NPVRR) metrics by incorporating additional planning objectives such as customer affordability and decarbonization, using scenario and sensitivity analyses to evaluate a range of uncertainties.

2.4.3 System Strength and Stability The next 25 years will see a dramatic transformation in the Nova Scotia generation mix as it moves further towards decarbonization. Theories and physics of power systems were developed around synchronous...

AI summary The document discusses the transformation of Nova Scotia's power generation mix over the next 25 years, emphasizing the shift from synchronous generators to inverter-based and lower-emitting technologies. This transition will impact system stability and require new approaches to ancillary services, as coal-fired generators retire and synchronous inertia decreases.

2.4.4 Long-Term Capacity Expansion Modeling Software In previous IRPs, Nova Scotia Power relied on Strategist, a resource planning tool supported by ABB Enterprise Software. This tool worked well when the system was predominantly dispatcha...

AI summary Nova Scotia Power is transitioning from the Strategist tool to PLEXOS LT and RESOLVE for long-term capacity expansion modeling due to the increasing integration of variable renewable resources. PLEXOS LT provides detailed optimization and production cost modeling, while RESOLVE offers faster scenario analysis and screening capabilities to support integrated resource planning.

2.5 Role of the IRP Working Group The approved Terms of Reference state that Nova Scotia Power is to complete the IRP process in collaboration with the Nova Scotia Utility and Review Board's (NSUARB) staff and its consultants. Nova Scotia...

AI summary Nova Scotia Power, in collaboration with NSUARB staff and consultants, has worked with the IRP Working Group to complete the Integrated Resource Plan process. The Working Group has provided feedback on modeling results, and Nova Scotia Power has aimed to gain support for its analysis and modeling approach.

2.6 Stakeholder Consultation and Public Process Nova Scotia Power's IRP establishes the strategic direction for the electricity future of Nova Scotia; stakeholder input is integral to this process. Commencing with the pre-IRP deliverables...

AI summary Nova Scotia Power's Integrated Resource Plan (IRP) emphasizes stakeholder consultation and public engagement throughout the process. A public website was established for transparency, and workshops were held at key milestones. Stakeholder input led to adjustments in analysis and additional modeling, enhancing the robustness of the IRP. Direct one-on-one meetings with stakeholders and their consultants also facilitated detailed discussions.

3 MEETING FUTURE OBJECTIVES Through the IRP process, Nova Scotia Power undertakes long-term system planning to understand how the electricity system will continue to meet the needs of customers and respond to changes in the electricity pla...

AI summary Nova Scotia Power uses the Integrated Resource Plan (IRP) process for long-term system planning to ensure the electricity system meets customer needs and complies with legislation over a 25-year horizon. The plan aims to make the system safe, reliable, affordable, clean, and robust under various future scenarios.

3.1.1 Planning Reserve Margin (PRM) The first step in planning for a reliable grid is load forecasting. Understanding how customer demand may change under different future scenarios is crucial to Nova Scotia Power's planning process. The l...

AI summary The document discusses the Planning Reserve Margin (PRM) as a key component of Nova Scotia Power's grid reliability planning. It outlines the process of load forecasting and the use of a reliability criterion based on a 1-day-in-10-years Loss-of-Load Expectation (LOLE) standard. This standard is translated into a PRM, which is a percentage requirement above expected peak demand to ensure system reliability.

3.1.2 Effective Load Carrying Capability When system reliability is maintained through a PRM requirement in the planning process, one of the most important steps is quantifying the amount of firm capacity provided by each existing and cand...

AI summary This section discusses the Effective Load Carrying Capability (ELCC) method for evaluating the contribution of dispatch-limited resources to system reliability. It explains how dispatch-limited resources like wind and solar have varying capacities based on conditions and how ELCC quantifies their actual contribution to resource adequacy. Nova Scotia Power used ELCC values in their Integrated Resource Plan (IRP), calculated using E3's RECAP model.

3.1.3 Ancillary Grid Services and Variable Renewable Energy Integration The Nova Scotia Power system, like all electric power systems, requires various ancillary grid services including ramping and load-following reserves, reactive power s...

AI summary The Nova Scotia Power system requires ancillary grid services such as ramping, reactive power support, and voltage control, which were previously provided by thermal and hydro generators. With the retirement of coal-fired units, alternative sources of these services are needed, especially as non-synchronous generation increases. Ancillary services like regulation reserve and synchronous inertia are modeled in the Integrated Resource Plan to ensure stable power system operation.

3.1.3.1 Regulation Reserve and Net Load Following Capabilities Regulation reserve is defined in this IRP as operating reserves which are available to respond quickly to changes in system net load, including wind ramping. Incremental quanti...

AI summary The document discusses regulation reserve and net load following capabilities in the context of the Integrated Resource Plan (IRP). It outlines how increasing variable generation, such as wind, necessitates additional ramping reserves. Historical wind data was analyzed using a 3-sigma approach to determine reserve requirements, and new wind generation can now provide ramp down reserve service in the PLEXOS model.

3.1.3.2 Synchronous Inertia Inertial Response is a key property of a power system which helps to ensure reliability. It is the ability of synchronous generators to release kinetic energy stored in their rotating generators in response to a...

AI summary This section discusses the importance of synchronous inertia in maintaining grid reliability, the impact of replacing coal-fired generators with inverter-based and gas turbine generators, and Nova Scotia Power's approach to ensuring sufficient inertia through system modeling and studies. The pre-IRP study recommended minimum inertia levels and the use of various sources to meet these requirements.

3.1.3.3 Variable Renewable Integration Requirements In addition to detailing the specific synchronous inertia and reserve requirements described above, the Stability Study for Renewable Integration looked at available options to enable win...

AI summary The Stability Study for Renewable Integration examined options to enable wind integration beyond 600 MW, identifying a second 345 KV AC tie and a domestic mitigation option with a synchronous condenser and battery. Nova Scotia Power allows parallel selection of these options in the IRP process, despite not being tested in the stability study.

3.2 Maintaining Affordability As reflected in the Terms of Reference for this IRP, in addition to the traditional metric of minimization of cumulative present value of annual long-term revenue requirements over the 25 year planning horizon...

AI summary The 2020 Integrated Resource Plan (IRP) considers affordability by analyzing the magnitude and timing of electricity rate effects across different scenarios, such as Electrification, DSM, and DER. Affordability is influenced by system load levels and cost recovery mechanisms, with uncertainty increasing over the planning horizon. Nova Scotia Power provides 10-year rate impact analyses to address risks associated with long-term projections.

3.3 Supplying Clean Energy Nova Scotia Power is working to increase the share of clean and renewable energy on the Nova Scotia Power system and has incorporated significant emissions reductions targets into this IRP that demonstrate that c...

AI summary Nova Scotia Power is committed to increasing clean and renewable energy on its system and has included emissions reduction targets in the Integrated Resource Plan (IRP). The company must comply with air emissions and renewable energy standards and regulations. Key factors in the IRP modeling process are discussed in this section.

Figure 16. Multi-Year Greenhouse Gas Emission Limits Period Greenhouse Gas Allowances (Million Tonnes) 2021-2024 27.5 (Total) 2025 6 2026-2029 21.5 (Total) 2030 4.5 The Sustainable Development Goals Act 29 sets out Nova Scotia's goals to a...

AI summary Figure 16 outlines multi-year greenhouse gas emission limits, with the Sustainable Development Goals Act (SDGA) setting ambitious emission reduction targets for Nova Scotia. These targets influence the Integrated Resource Plan (IRP) modeling, with two of the three modeled GHG curves projected to reach net-zero emissions by 2050.

3.3.4 Modeling of GHG Emissions and Coal Unit Retirements Nova Scotia Power, together with input from IRP participants, developed a set of modeling assumptions that combine the various regulations, targets, and other policy components desc...

AI summary Nova Scotia Power, with input from IRP participants, developed GHG emission trajectories and coal retirement scenarios aligned with provincial and federal carbon reduction goals. Two net-zero trajectories (2050 and 2045) and a comparator trajectory are modeled alongside two coal retirement timelines (2040 and 2030). These form the basis for IRP modeling scenarios.

3.3.5 Maritime Link Nova Scotia is interconnected with Newfoundland via a 500 MW, +/-200kV DC Maritime Link tie that was placed into service on January 15, 2018 in preparation for receiving capacity and energy from the Muskrat Falls Hydro...

AI summary Nova Scotia is connected to Newfoundland via the 500 MW Maritime Link, which was activated in 2018 to support energy from the Muskrat Falls project. Nalcor paused construction in 2020 due to the pandemic but resumed in May 2020. The Integrated Resource Plan (IRP) assumes full availability of Muskrat Falls energy by 2021, though delays are not expected to significantly impact long-term planning.

4.1 Load Forecast A key input to Nova Scotia Power's IRP process is the load forecast. In this IRP, Nova Scotia Power enhanced the load forecast methodology to incorporate uncertainty from potential increased economywide electrification as...

AI summary Nova Scotia Power updated its load forecast methodology for the Integrated Resource Plan (IRP) to account for increased electrification and customer adoption of distributed technologies. The forecast includes base load, electrification scenarios, demand-side management (DSM) scenarios, and distributed energy resources (DER) impacts, with various combinations used for capacity expansion modeling.

4.1.1 Base Load Forecast The Base Load Forecast relies on demographic and economic indicators (e.g. population and economic growth), historical sales data, weather variables (e.g. cooling degree days and heating degree days), and other fac...

AI summary The Base Load Forecast considers demographic, economic, and weather factors to predict energy demand. Nova Scotia Power's largest customer, Port Hawkesbury Paper LP, transitioned to the ELIADC Tariff in 2020, which includes Active Demand Control to manage load and reduce costs. The NSUARB recognized the ELIADC Tariff's benefits in system flexibility and cost management.

4.1.2 Electrification The electrification load component is based on the range of electric load trajectories captured in the Deep Decarbonization Pathways report, which assessed the potential impact of economy-wide decarbonization on the e...

AI summary The electrification load component is based on the Deep Decarbonization Pathways report, which assesses the impact of economy-wide decarbonization on Nova Scotia's electricity sector. Nova Scotia Power developed three electrification levels (low, mid, and high) for use in the Integrated Resource Plan scenarios, each reflecting different degrees of electrification in buildings and transportation.

Figure 22. Electrification Scenario Details Low Electrification Mid Electrification High Electrification Sales of electric 25% sales of air source heat pumps for space heating by 2050 50% sales of heat pump space heaters and water heaters...

AI summary Figure 22 outlines electrification scenarios with varying levels of adoption of electric heat pumps, water heaters, and vehicles. The Mid and High Electrification scenarios show significantly higher growth in peak and annual energy load due to increased electrification. Demand Side Management (DSM) mitigates this growth, with the Low Electrification scenario showing a net decline in load.

4.1.3 Demand Side Management Demand Side Management (DSM) is an important component of the IRP modeling process, as the decision to pursue various potential levels of DSM has a significant impact on the future load required to be served by...

AI summary Demand Side Management (DSM) plays a key role in the Integrated Resource Plan (IRP) by influencing future energy load and costs. Nova Scotia Power worked with EfficiencyOne (E1) to develop DSM scenarios and ensure accurate modeling. The IRP will evaluate avoided costs of capacity and energy, as well as potential T&D savings, which are being updated separately.

4.1.4 Distributed Energy Resources The potential for customer adoption of Distributed Energy Resources (DER), such as rooftop solar PV, is taken into consideration in the IRP modeling. Distributed Energy Resources are not offered to the mo...

AI summary The text discusses the consideration of Distributed Energy Resources (DER) in Nova Scotia Power's Integrated Resource Plan (IRP) modeling. DER are not modeled as supply-side options but are evaluated through load modification scenarios. The text outlines two adoption scenarios: moderate and high, with associated capacity forecasts and estimated customer costs.

4.1.5 COVID-19 Impacts The COVID-19 pandemic began affecting Nova Scotia in March 2020 during the Resource Screening and Initial Portfolio Study phases of the IRP process. Based on the anticipated potential impacts of the pandemic, and on...

AI summary The COVID-19 pandemic affected Nova Scotia in March 2020, leading to reduced commercial and industrial electricity demand, partially offset by increased residential usage. Nova Scotia Power modeled a 1% peak demand reduction and 5% energy reduction in 2021, reverting to original forecasts by 2026. The impact was most pronounced in April and May 2020, with a 5% decline in electricity sales from forecasts, though this has since diminished.

4.2.2 Resource Screening Nova Scotia Power engaged E3 to perform a Resource Screening analysis for existing diesel combustion turbines and domestic hydro facilities. The goal was to determine whether it would be more economic to retire or...

AI summary Nova Scotia Power conducted a Resource Screening analysis using E3's RESOLVE model to determine the economic viability of existing diesel and hydro facilities. The analysis aimed to decide whether to retire or sustain these resources, reducing model complexity and computation time by narrowing retirement decisions. Results were discussed in a stakeholder workshop.

Resource Screening - Diesel Combustion Turbines 4.2.2.1 The Screening Analysis evaluated the existing fleet of seven diesel combustion turbines (CTs) by comparing the cost of retirement (and replacement with alternatives) to the cost of su...

AI summary The Screening Analysis evaluated the cost of sustaining versus retiring seven diesel combustion turbines, concluding that sustaining them is the lowest-cost option for meeting system capacity requirements. Replacing them with gas turbines was significantly more expensive over a 25-year NPV. Sensitivity analyses at Victoria Junction also supported sustaining the existing units.

4.2.2.2 Resource Screening - Domestic Hydro The Resource Screening analysis also evaluated the existing fleet of domestic hydro resources. The methodology followed was generally similar to the Diesel CT screening described in the previous...

AI summary The Resource Screening analysis evaluated Nova Scotia Power's domestic hydro resources using a 40-year horizon, considering sustaining capital, O&M, and decommissioning costs. The Mersey and Wreck Cove systems were analyzed individually, while other resources were grouped based on similar operating characteristics. The analysis was conducted under two key scenarios: 1.0A and 2.1C.

4.3 Future Supply Options Nova Scotia Power evaluated a wide array of potential future resource options in this IRP, including renewable resources, energy storage resources, thermal resources, and firm contracts for imports. Assumptions we...

AI summary Nova Scotia Power evaluated various future resource options, including renewable, storage, thermal, and import contracts, using a Resource Options Study. Levelized costs of capacity for these resources are analyzed, showing declining costs for lithium-ion batteries and continued low costs for gas combustion turbines.

4.3.1.3 Biomass Nova Scotia Power estimates that a biomass project will require upfront capital investment costs of $5,300/kW, based on NREL 2019 ATB ($5,446/kW) but adjusted lower as informed by local engineering estimates. Figure 32 belo...

AI summary Nova Scotia Power estimates the upfront capital investment cost for a biomass project at $5,300/kW, adjusted from the NREL 2019 ATB estimate of $5,446/kW based on local engineering estimates. This information is used in the Integrated Resource Plan.

4.3.1.4 Municipal Solid Waste Municipal solid waste capital costs are typically location specific. Nova Scotia Power estimates upfront capital costs of $8,470/kW. Figure 33 below summarizes key assumptions for municipal solid waste generat...

AI summary The document discusses municipal solid waste capital costs, noting that they are location-specific. Nova Scotia Power estimates upfront capital costs at $8,470/kW, with Figure 33 summarizing key assumptions for municipal solid waste generation used in the Integrated Resource Plan (IRP).

4.3.1.5 Tidal Nova Scotia Power estimates that a new tidal project will have a capital cost of $10,000/kW. Nova Scotia has been a global leader in developing tidal power; however, tidal power is still an expensive technology with limited c...

AI summary Nova Scotia Power estimates a new tidal project will cost $10,000 per kW. Tidal power is recognized as an expensive technology with limited commercial deployment, despite Nova Scotia's leadership in its development. Key assumptions for tidal power are outlined in the Integrated Resource Plan.

4.3.2.2 Compressed Air Energy Storage Compressed air energy storage (CAES) costs are highly site-specific and can vary considerably based on the characteristics of the site (geology, etc.). The lack of recent commercial projects adds to co...

AI summary Compressed air energy storage (CAES) costs are site-specific and influenced by geological factors. Nova Scotia Power estimates capital costs at $2,200/kW, lower than WECC's $2,836/kW. Natural gas fuel costs add to expenses, but CAES is competitive for long-duration storage and contributes to system inertia. Assumptions for CAES are detailed in the Integrated Resource Plan (IRP).

New combined-cycle natural gas plants with Carbon Capture and Storage (CCS) are also considered in the IRP. CCS capital costs include the cost of capturing and compressing the ${\rm CO_2}$ , but not delivery and storage to a storage reserv...

AI summary The Integrated Resource Plan (IRP) considers new combined-cycle natural gas plants with Carbon Capture and Storage (CCS). Nova Scotia Power includes an additional $4.76/MWh in variable O&M costs to account for transport and storage costs of captured CO2, which are not included in the CCS capital costs.

4.4 Future Demand Options New technologies are emerging that allow greater load control and customer response. These demand response (DR) technologies can affect system operations primarily by changing the timing of electricity consumption...

AI summary The document discusses future demand options, particularly demand response (DR) technologies, which can influence system operations by altering electricity consumption timing. Nova Scotia Power evaluated DR profiles (Low, Base, High) paired with DSM levels, offering them in the IRP optimization model for 2021, 2025, and 2030, with cost profiles adjusted for inflation.

4.5 Regional Integration Nova Scotia Power has achieved meaningful greenhouse gas emissions reductions in recent years via domestic infrastructure investments. As the transition to a low-carbon power system continues through the IRP planni...

AI summary Nova Scotia Power has made progress in reducing greenhouse gas emissions through domestic investments. As the transition to a low-carbon system continues, exploring regional integration options may become economically viable to meet energy needs and improve interconnection with neighboring systems.

4.5.1 Existing Transmission Interconnections Nova Scotia Power has two existing interconnections to neighboring regions: the Maritime Link connecting Nova Scotia to Newfoundland, and an existing AC interface connecting Nova Scotia to New B...

AI summary Nova Scotia Power has two existing transmission interconnections: the Maritime Link to Newfoundland and an AC interface to New Brunswick. These interconnections are included in the Integrated Resource Plan (IRP) model. The Maritime Link provides access to energy and capacity resources, while the AC interface has limited firm import capacity due to reliability and transmission constraints.

4.5.2 Transmission Expansion Options This IRP explored two transmission expansion options as part of the suite of integrated resources available to the model. The first is the development of a Reliability Tie, which allows for the integrat...

AI summary The Integrated Resource Plan (IRP) evaluated two transmission expansion options: a Reliability Tie and a Regional Interconnection. The Reliability Tie provides system inertia and integrates renewable generation, while the Regional Interconnection offers access to firm capacity and energy in addition to reliability benefits.

Firm Import Options: - • Access to firm capacity via existing transmission up to ~150 MW firm; and/or, - • Access to firm capacity via new transmission build up to ~450 MW firm

AI summary The document outlines two options for accessing firm import capacity: utilizing existing transmission up to 150 MW or building new transmission to access up to 450 MW of firm capacity.

4.6 Resource Strategies Nova Scotia Power developed three Resource Strategies for use in this IRP. These strategies are intended to capture different subsets of supply and demand-side resources, to allow for a comparison of strategic alter...

AI summary Nova Scotia Power developed three Resource Strategies (A, B, C) for its Integrated Resource Plan (IRP) to compare different supply and demand-side resource scenarios. Strategy A models current in-province resources, Strategy B focuses on increased DER adoption, and Strategy C explores regional integration for accessing out-of-province resources to meet GHG reduction and reliability goals.

5.1 Key Scenarios Nova Scotia Power's objective in this IRP is to model a wide range of potential future scenarios and use this range of results to identify near-term options that are common among many resource plans. In this way, a no-reg...

AI summary Nova Scotia Power is developing an Integrated Resource Plan (IRP) by modeling various future scenarios based on key policy drivers, including decarbonization, load electrification, and resource strategy. These scenarios are designed to identify common near-term options and support the development of a no-regrets Action Plan and Roadmap.

5.2.3 Mersey Hydro While the Mersey system was economically retained in the resource screening phase of the IRP, this sensitivity was completed to understand how capacity and energy would be replaced in the IRP PLEXOS model if the Mersey s...

AI summary The Mersey Hydro system was economically retained in the IRP resource screening phase, but a sensitivity analysis was conducted to assess how capacity and energy would be replaced in the IRP PLEXOS model if the Mersey system retires in 2025.

5.2.5 Sustaining Capital To understand the robustness of retaining the existing thermal steam fleet (both coal fired and gas/HFO fired), Nova Scotia Power executed two sensitivities on sustaining capital. These help to interpret the econom...

AI summary Nova Scotia Power conducted two sensitivities to assess the economic impact of sustaining capital on retaining the existing thermal steam fleet, including coal and gas/HFO fired units, and to evaluate how sensitive projected retirement dates are to these assumptions.

5.3.1 Developing Resource Portfolios Nova Scotia Power utilized the PLEXOS capacity expansion and production simulation modeling software in developing the optimal resource portfolios during the Portfolio Study phase of the IRP. PLEXOS is...

AI summary Nova Scotia Power used PLEXOS modeling software to develop optimal resource portfolios from 2021 to 2045, minimizing investment and operation costs while meeting GHG reduction targets and reliability constraints. The PLEXOS modules were used for capacity expansion, production cost modeling, and system operability checks.

5.3.2 Assessing Reliability One of the objectives of the IRP Portfolio Analysis is to ensure that the modeled resource plans meet the established reliability criterion (see Section 3.1 for details on the selection of a reliability criterio...

AI summary The IRP Portfolio Analysis ensures resource plans meet reliability criteria, using the Planning Reserve Margin and resource capacity values. E3's RECAP model is used in two stages to assess the existing system and evaluate optimal resource plans, aiming to meet Nova Scotia Power's reliability criterion of 1-day-in-10-years LOLE.

5.3.3 Assessing Operability To access the operational behaviour of the future resource portfolio, Nova Scotia Power conducted and reviewed hourly unit commitment simulations in PLEXOS MT/ST for several key scenarios, including scenarios th...

AI summary Nova Scotia Power conducted hourly unit commitment simulations in PLEXOS to assess the operability of future resource scenarios, including those with high variable generation and thermal unit retirements. These simulations help validate system and unit operability constraints and refine capital assumptions for the Final Portfolio Study.

5.3.4 Assessing Relative Rate Impacts As discussed in Section 3.2, Nova Scotia Power believes it is important to analyze and consider financial metrics in addition to Net Present Value of Revenue Requirement when assessing IRP modeling res...

AI summary Nova Scotia Power emphasizes the importance of analyzing financial metrics, in addition to Net Present Value of Revenue Requirement, to assess the impacts of different Integrated Resource Plan scenarios on customer rates. This includes considering how demand-side measures like electrification and energy efficiency affect both utility revenues and costs.

5.4 Evaluation of Resource Portfolios One of the main objectives of the IRP is to develop a robust, risk-weighted lowest-cost long-term electricity strategy that delivers energy in a safe and reliable manner. In addition, Nova Scotia Power...

AI summary Nova Scotia Power evaluates resource portfolios using metrics like 25-year NPVRR, resource adequacy, GHG emissions, and robustness to ensure affordability, reliability, and decarbonization. The Integrated Resource Plan (IRP) considers various scenarios, including the impact of DSM, DER penetration, and electrification on costs and rates.

6 MODELING RESULTS The assumptions, constraints, and scenarios developed through the initial stages of the IRP Process provide the inputs necessary to execute the Initial Portfolio Study, Reliability and Operability Analysis, and Final Por...

AI summary The modeling results from Nova Scotia Power's 2020 Integrated Resource Plan (IRP) highlight the common elements in low-cost resource plans, despite high uncertainty in the electricity planning environment. Scenario 2.0C is designated as the Reference Plan due to its lowest 25-year NPVRR, and other low-cost scenarios are discussed to highlight shared characteristics in resource selection and timing.

6.1 Resource Additions and Retirements IRP resource plans are largely described via their resource additions and retirements. In order to communicate these plans, Nova Scotia Power has developed an incremental capacity diagram that has bee...

AI summary The Integrated Resource Plan (IRP) outlines resource additions and retirements, including the retirement of coal units and the addition of gas peaking units, wind resources, and demand response. Solar resources are not selected in the current scenarios but may be included under an accelerated GHG reduction trajectory.

6.4 Resource Plan Cost The NPV of partial revenue requirement for the IRP key scenarios is summarized in Figure 51 below. Results for scenarios are grouped based on their load level; the revenue requirements should only be compared across...

AI summary The document discusses the NPV of revenue requirements for different Integrated Resource Plan (IRP) scenarios, noting that scenarios with regional integration are lower cost than others. It also highlights the higher costs associated with retiring coal plants earlier, and notes that the cost of distributed energy resources is not included in the NPV calculations for certain scenarios.

6.5 Relative Rate Impacts In addition to comparing the NPVRR metrics, Nova Scotia Power also developed a simplified rate impact model to compare the relative rate impacts of each scenario. This analysis approximates the resource plan impac...

AI summary Nova Scotia Power developed a simplified rate impact model to compare the relative rate impacts of different scenarios, incorporating factors like electrification, DSM level, and resource strategy. The model's results are visualized in Figure 52 and detailed in Section 5.3.4.

6.6 Reliability As described in Section 5.3.2, Nova Scotia Power included a Reliability Assessment phase in the IRP process due to the significant changes in generating capacity anticipated by the end of the planning horizon. Scenarios 2.0...

AI summary Nova Scotia Power conducted a reliability assessment as part of the Integrated Resource Plan (IRP) process, analyzing scenarios with significant renewable energy penetration by 2045. All three scenarios met the reliability criterion of 0.1 days/year loss of load expectation (LOLE), with installed firm capacity close to the lowest cost firm capacity unit.

While these results provide confidence that these systems are sufficiently reliable, detailed modeling of electrification impacts on reliability is recommended as additional electrification shape data becomes available. More detailed model...

AI summary The text discusses the need for detailed modeling of electrification impacts on reliability and the PRM target in the long-term. Nova Scotia Power will continue to assess the appropriateness of the current PRM and its components as the power system evolves. Updates to the PRM analysis were made following the IRP modeling process to ensure the 9 percent UCAP PRM remains appropriate for near-term capacity planning.

6.7 Operability For select scenarios, Nova Scotia Power used the PLEXOS MT/ST module between the Initial and Final Portfolio Studies in order to produce hourly production cost model outputs. These more granular simulations were reviewed to...

AI summary Nova Scotia Power used the PLEXOS MT/ST module to conduct hourly production cost model simulations for four scenarios during the Operability Assessment phase. The simulations confirmed that key model constraints were met, thermal unit operating parameters were respected, and minor refinements were made to import constraints for the Final Portfolio Study.

6.7.1 Operating Reserve Provision An item of interest in this IRP is an analysis of Operating Reserve provision, to understand whether any changes to current operating practice are indicated by the IRP modeling results. The IRP model incor...

AI summary The Integrated Resource Plan (IRP) analysis examines the Operating Reserve provision, incorporating minimum reserve requirements set by the Nova Scotia Power System Operator. The IRP model co-optimizes generation and reserve provision, resulting in surplus reserves beyond minimum requirements as part of the lowest-cost solution. Hourly Production Cost model outputs show an average of 471 MW of operating reserve, similar to recent audit results.

6.8 Sensitivity Analysis In addition to the Final Portfolio Study, various model sensitivities were studied to understand how model outputs will vary with adjustments to key input parameters of interest. For each of the 18 sensitivities, a...

AI summary A sensitivity analysis was conducted to assess how changes in key input parameters affect the optimal resource plan and costs. The analysis was performed on 18 sensitivities, with results grouped into categories such as DSM Levels, Wind, Mersey System, Imports, Sustaining Capital, and Fuel Prices. The findings are detailed in the updated IRP Modeling Results from October 30, 2020.

6.8.3 Mersey System The Mersey Hydro system was analyzed during the Resource Screening phase of the IRP (described in Section 4.2.2) and economically retained, based on the assumptions developed from Nova Scotia Power's Hydro Asset Study (...

AI summary The Mersey Hydro system was analyzed in the Integrated Resource Plan (IRP) and retained economically. However, due to redevelopment costs, a PLEXOS sensitivity analysis was conducted assuming the Mersey system retires in 2025. Results show redevelopment is economically viable compared to decommissioning, with similar rate impacts but differences in NPVRR metrics over 25 years.

6.8.4 Imports Because Regional Integration and the Reliability Tie play a key role in many of the optimal resource plans developed for the key scenarios, three import sensitivities were modeled in order to evaluate the robustness of this f...

AI summary The document evaluates the impact of three import sensitivities on Nova Scotia's Integrated Resource Plan (IRP). Reducing non-firm imports leads to earlier wind and natural gas combined-cycle unit development. Removing the Reliability Tie results in less wind and higher costs. The Reliability Tie's contribution to inertia is tested, showing that its full inertia provision is not critical to the asset's value.

6.8.5 Sustaining Capital Evaluating ongoing sustaining capital investments for existing generating units is an important part of the IRP process. In particular, during this period of significant system transformation, the sustaining capita...

AI summary This section discusses the evaluation of sustaining capital investments for existing generating units as part of the Integrated Resource Plan (IRP) process. Two sensitivity scenarios—High and Low sustaining capital—are analyzed, showing how changes in sustaining capital affect retirement timelines and resource planning, with the base case being the most economically viable for customers.

6.8.6 Gas and Import Prices The optimal resource plans developed for the key scenario runs show that both new gas generation and new firm imports are selected as common resources across scenarios as part of the overall strategy to replace...

AI summary Nova Scotia Power's resource plans show that new gas generation and firm imports remain key despite high-sensitivity testing of natural gas and import power prices. Minor adjustments include gas steam unit retirements and delays in the Regional Interconnection, with higher overall costs due to increased commodity prices.

7.1 Key Findings The Key Findings are compiled from the modeling results and other observations developed throughout the IRP Process, including the outputs of the Pre-IRP Deliverables. They are intended to capture the major outputs of the...

AI summary The key findings highlight the need for significant efforts across all sectors to reduce carbon emissions in line with Nova Scotia's Sustainable Development Goals Act, emphasizing the critical role of the electricity sector in achieving these goals.

7.2 Action Plan As set out in the IRP Terms of Reference, The IRP Action Plan describes the key tasks to be undertaken in the next five years to implement the long-term electricity strategy. These Action Plan items are built on the items i...

AI summary The IRP Action Plan outlines steps for developing a regional integration strategy to enhance reliability and access to low-carbon energy, and proposes an electrification strategy to support decarbonization while maintaining rate stability. Key actions include developing a reliability tie and regional interconnection, conducting studies on firm import options, and initiating electrification programs with oversight from UARB.

7.3 Roadmap As described in the IRP Terms of Reference, the IRP Roadmap is designed to identify signposts to monitor and decision gates to be addressed in order to enable the appropriate triggering of changes to the Strategy, based on futu...

AI summary The IRP Roadmap outlines key monitoring variables and decision points for Nova Scotia Power to refine its long-term strategy. It includes advancing engineering studies on coal-to-gas conversions and conducting system stability studies to evaluate grid impacts from increased wind capacity and new ancillary services.

........................................................................ 47 4 Conclusions .......................................................................................................49 4.1 Key Findings and Implications for NSPI...

AI summary The document outlines the conclusions and key findings of Nova Scotia Power Inc.'s (NSPI) Integrated Resource Plan (IRP) Final Report, including recommendations for further analysis. Appendices include mitigation scenario results, additional scenarios, and biofuels tables. The report is part of a regulatory proceeding involving the Nova Scotia Utility and Review Board (UARB).

esources Canada (Department of Natural Resources) NSPI Nova Scotia Power Inc. SDGA Sustainable Development Goals Act UARB Nova Scotia Utility and Review Board 1 P a g e © 2020 Energy and Environmental Economics, Inc. Nova Scotia Power IRP...

AI summary Nova Scotia's Sustainable Development Goals Act (SDGA) sets GHG emission targets, with Nova Scotia Power Inc. (NSPI) leading efforts to decarbonize its operations and support electrification. NSPI commissioned Energy and Environmental Economics, Inc. (E3) to analyze strategies for achieving province-wide GHG reductions across electricity, buildings, and transportation sectors.

ronmental Economics, Inc. (E3) to perform an independent analysis of strategies to achieve long-term, province-wide GHG reductions, with a focus on electricity, buildings, and transportation sectors. This study, commissioned prior to passa...

AI summary Energy and Environmental Economics, Inc. (E3) was commissioned to analyze strategies for achieving 80% GHG emission reductions below 2005 levels by 2050 in Nova Scotia, focusing on electricity, buildings, and transportation. The study highlights the need for additional abatement measures beyond existing policies, including Nova Scotia’s hard caps on electricity sector emissions, to meet deep decarbonization targets.

ls under existing policy (prior to SDGA), such as Nova Scotia’s hard caps on electricity sector GHGs. The “Mitigation” scenarios demonstrate the incremental effort required to achieve the 80% target. Figure 2 presents Nova Scotia emissions...

AI summary The text discusses Nova Scotia's GHG emissions under existing policy, focusing on the need for mitigation scenarios to achieve an 80% emissions reduction target. E3's analysis highlights electricity generation, buildings, and transportation as key sectors, using PATHWAYS modeling to explore decarbonization pathways. Figure 2 illustrates 2016 emissions by sector, with electricity generation being a major contributor.

ns accounting tool; E3 has used PATHWAYS in 1 Greenhouse Gas Inventory from Environmental and Climate Change Canada: https://open.canada.ca/data/en/dataset/779c7bcf-4982-47eb-af1b- a33618a05e5b 4 P a g e © 2020 Energy and Environmental Eco...

AI summary E3 developed a customized PATHWAYS model for Nova Scotia's decarbonization, identifying four pillars: energy efficiency, electrification, low-carbon fuels, and low-carbon electricity. The model uses scenario-based analysis to address uncertainties in technology costs and availability, as detailed in the Nova Scotia Power IRP Final Report.

5 P a g e © 2020 Energy and Environmental Economics, Inc. Nova Scotia Power IRP Final Report Appendix A Page 11 of 64 (business-as-usual) scenario and three core “mitigation” scenarios (Building Electrification Only, Moderate Electrificati...

AI summary E3's PATHWAYS model analysis for Nova Scotia Power's Integrated Resource Plan (IRP) outlines scenarios for deep decarbonization, emphasizing sectoral synergy and low-carbon electricity's role. Key findings include the need for cross-sectoral efforts and electrification to achieve 80% GHG reductions by 2050.

Nova Scotia Power IRP Final Report Appendix A Page 14 of 64 Figure 6. Emissions Reduction by Strategy for the High Electrification Scenario 4. Long lifetimes require early action. Investments in infrastructure and equipment can last decade...

AI summary The text emphasizes the need for early action in infrastructure investments to meet 2050 emissions goals, highlighting the long-term impacts of electrification and low-carbon infrastructure. It notes the challenge of achieving near-complete passenger vehicle electrification by 2050, given current low EV adoption, and stresses the importance of public charging infrastructure and strategic planning by NSPI.

roximately 60% of the Company’s electricity supply portfolio. The next largest source of emissions is on-road transportation, which makes up almost a quarter of emissions in Nova Scotia as of 2016. 11 P a g e © 2020 Energy and Environmenta...

AI summary The text outlines Nova Scotia's GHG emissions sources, highlighting electricity supply (60%) and on-road transportation (25%) as major contributors. It introduces a study on decarbonization pathways, focusing on electricity sector reductions and electrification impacts, using the PATHWAYS model framework for analysis.

13 P a g e © 2020 Energy and Environmental Economics, Inc. Nova Scotia Power IRP Final Report Appendix A Page 19 of 64 E3’s PATHWAYS modeling includes detailed information regarding energy infrastructure including power plants, trucks, car...

AI summary E3's PATHWAYS model provides detailed, technology-specific accounting of energy infrastructure lifetimes to inform decarbonization strategies. It emphasizes long-term impacts of near-term investments and links sectors (e.g., electricity and transportation) to identify synergies in emissions reduction.

built a bottom-up PATHWAYS model of the Nova Scotia economy using the LEAP tool (Long-range Energy Alternatives Planning System) 2 . This modeling tool implements the framework described above and is customized to the desired region. In pa...

AI summary E3 developed a PATHWAYS model for Nova Scotia using the LEAP tool to project energy and emissions trends through 2050, focusing on non-electricity sectors. The model uses carbon intensity ranges rather than detailed electricity sector modeling, with a recommendation for deeper analysis within the IRP or future studies.

led electricity sector modeling should be performed within the context of the IRP or in future NSPI study Figure 9. PATHWAYS Energy Modeling Framework Utilized for Nova Scotia Study 2.4 Scenarios The study considers one reference scenario,...

AI summary The document outlines the use of the PATHWAYS modeling framework in Nova Scotia's Integrated Resource Plan (IRP) study, emphasizing GHG reduction targets. The Reference Scenario aligns with the 2030 provincial target of 45-50% GHG reduction below 2005 levels, while mitigation scenarios aim for 80% reductions by 2050. The study incorporates current policy measures and energy efficiency initiatives.

17 P a g e © 2020 Energy and Environmental Economics, Inc. Nova Scotia Power IRP Final Report Appendix A Page 23 of 64 Two additional “bookend” scenarios –one focusing on more extreme reliance on biofuels and the other focusing on more ext...

AI summary The document outlines two extreme scenarios in Nova Scotia Power's Integrated Resource Plan (IRP): heavy reliance on biofuels and extreme electrification. Key assumptions from these scenarios are detailed in Table 1, developed by E3 using public data, distinct from NSPI's assumptions. Figure 10 illustrates historical GHG emissions and 2050 targets.

nmental Economics, Inc. Nova Scotia Power IRP Final Report Appendix A Page 24 of 64 Table 1. Key Assumptions Across Scenarios

AI summary The text references a table titled 'Key Assumptions Across Scenarios' from Nova Scotia Power's Integrated Resource Plan (IRP) Final Report Appendix A. The table's purpose is to outline critical assumptions used in different scenarios within the IRP, though no specific data is visible in the provided text.

19 P a g e © 2020 Energy and Environmental Economics, Inc. Nova Scotia Power IRP Final Report Appendix A Page 25 of 64 2.5 Model Inputs As described above, PATHWAYS is a stock rollover modeling framework which projects energy demands and t...

AI summary The PATHWAYS model, developed by E3 for Nova Scotia Power's Integrated Resource Plan (IRP), uses data from NEMS and AEO 2019 to project energy demands and GHG emissions. It benchmarks 2016 emissions against Canadian government data and assumes flat population and VMT growth from 2015-2050, despite NEB forecasts of slight population decline.

0 P a g e © 2020 Energy and Environmental Economics, Inc. Nova Scotia Power IRP Final Report Appendix A Page 26 of 64 2.5.3 BUILDING SECTOR 2.5.3.1 Base Year In 2016, Nova Scotia had a population of about 942,000 people residing in about 4...

AI summary The 2016 base year analysis for Nova Scotia's buildings sector decomposes energy use by device type and quantity, using NRCAN and NEMS data. Residential sectors use physical device counts (e.g., furnaces), while commercial sectors use square footage metrics due to heterogeneity. Data gaps are filled with NEMS regional data.

e for the Nova Scotia province, and for commercial subsectors an emissions-weighted downscale of the Atlantic provinces region are used. 4 National Energy Use Database by Natural Resources Canada: http://oee.nrcan.gc.ca/corporate/statistic...

AI summary The text references energy consumption data from Nova Scotia's building sector, citing the National Energy Use Database by Natural Resources Canada and a US Energy Information Administration report. It includes a table from Nova Scotia Power's Integrated Resource Plan (IRP) detailing 2016 building energy consumption by subsector.

Sector Subsector Modeling Approach Energy Use in Percent of 2016 2016 [TBtu] Building Energy Use [%] Residential Central Air Conditioning Stock Rollover 0.09 0% Room Air Conditioning Stock Rollover 0.09 0% Building Shell+ Stock Rollover -...

AI summary The table categorizes residential energy use by subsector (e.g., heating, lighting, appliances) under a 'Stock Rollover' modeling approach, showing energy use in TBtu and percentages of total building energy use. Notable entries include space heating (28.20 TBtu) and appliances like clothes drying (0.83 TBtu).

© 2020 Energy and Environmental Economics, Inc. Nova Scotia Power IRP Final Report Appendix A Page 28 of 64 2.5.3.2 Reference Scenario The primary measure represented in buildings for the Reference Scenario is the achievement of electric e...

AI summary The Reference Scenario in the Integrated Resource Plan (IRP) emphasizes building energy efficiency through device efficiency improvements and electrification. The PATHWAYS model assumes increased adoption of high-efficiency appliances, lighting, and heat pumps, with 20% of space heater sales being heat pumps by 2020. Efficiency gains from new equipment replacing outdated stock are modeled using NEMS forecasts.

Nova Scotia Power IRP Final Report Appendix A Page 29 of 64 Figure 11. Stock Rollover from the Reference Case: Residential Space Heating Since the model is based on a bottom-up forecast of technology stock rollover in the residential and c...

AI summary The document discusses Nova Scotia Power's Integrated Resource Plan (IRP) modeling approach, which uses a bottom-up forecast of technology stock rollover in residential and commercial sectors. It highlights mitigation scenarios focusing on building retrofits for energy efficiency and electrification, noting dependencies on incentives, technology trends, and fuel costs.

Nova Scotia Power IRP Final Report Appendix A Page 49 of 64 Figure 23. Annual Electricity Demand (excluding losses) by Scenario, 2015-2050 As Table 8 shows below, in all mitigation cases the electric sector achieves over 80% emissions redu...

AI summary The document discusses electricity demand and emissions reduction targets in Nova Scotia, highlighting that all mitigation scenarios achieve over 80% emissions reductions by 2050. Even with high electrification, the electric sector must meet an 80% decarbonization target, and the analysis emphasizes the need for detailed simulations to evaluate costs, reliability, and resource constraints.

IRP Final Report Appendix A Page 51 of 64 efficiency of the heat pump technology (Figure 24). The Moderate Electrification case could generate a smaller peak impact of between 155 MW and 552 MW. This analysis shows the impact of heat pump...

AI summary The analysis explores the impact of heat pump electrification on peak electricity loads in Nova Scotia, estimating a potential increase of 155 MW to 552 MW. It highlights the need for further investigation into peaking capacity requirements and reliability impacts, while suggesting mitigation strategies such as ground source heat pumps and hybrid systems with existing thermal backup sources.

48 P a g e © 2020 Energy and Environmental Economics, Inc. Nova Scotia Power IRP Final Report Appendix A Page 54 of 64 4 Conclusions This climate pathways analysis illustrates that achieving deep decarbonization will require tremendous shi...

AI summary This section outlines key findings from the climate pathways analysis, emphasizing the need for synergistic action across sectors and the importance of low-carbon electricity in achieving deep decarbonization in Nova Scotia by 2050. The report highlights the necessity of accelerating initial transformation efforts and the role of NSPI in supporting the transition.

a global market. Nova Scotia should therefore monitor the development of these emerging energy sectors and perform more detailed assessments of their potential deployment in Nova Scotia. 4. Long lifetimes require early action. Investments...

AI summary The document emphasizes the need for Nova Scotia to monitor emerging energy sectors and invest early in long-lasting infrastructure to meet 2050 emissions targets. It highlights the importance of electrification, especially for passenger vehicles, and the need for public charging infrastructure to support adoption.

nd Environmental Economics, Inc. Nova Scotia Power IRP Final Report Appendix A Page 57 of 64 4.2 Recommendations for Additional Analysis The scenarios evaluated in this analysis represent an initial modeling assessment of strategies to dec...

AI summary The report outlines the need for additional analysis in Nova Scotia's Integrated Resource Plan (IRP) process, emphasizing the importance of cost modeling and electricity sector modeling to better understand decarbonization pathways and their economic and operational impacts.

electric hybrid sales by 2050 HDVs: 10% compressed Buses: 95% EV sales by 2040 natural gas sales and 0.5% EV sales by 2050 Buses: 5% EV sales by 2030 Other transportation None 60% of total energy is electrified by None 2050 including rail,...

AI summary The text outlines transportation and industry electrification targets, including EV sales projections for buses and HDVs, as well as biofuel strategies using agricultural and forestry residues. It also references the Nova Scotia Power Integrated Resource Plan (IRP) and Energy and Environmental Economics, Inc.

e © 2020 Energy and Environmental Economics, Inc. Nova Scotia Power IRP Final Report Appendix A Page 61 of 64 5.3 Biofuels Tables

AI summary This section of the document discusses biofuels tables as part of the Integrated Resource Plan (IRP) final report by Nova Scotia Power. It provides data related to biofuels, though specific details are not outlined in the provided text.

14.700 84.63 Trees Hardwood, upland, residue Forest Residues gasification 14.700 84.63 Hardwood, upland, tree Purpose-Grown gasification 14.700 84.63 Trees Hogs, 1000+ head Manure anaerobic digestion 7.415 79.81 MSW wood Other MSW (Wood) g...

AI summary The text presents data on various biomass sources and their associated energy production values, including types of trees, agricultural residues, and manure, along with corresponding energy outputs and costs. The data is part of an appendix in Nova Scotia Power's Integrated Resource Plan (IRP) final report.

56 P a g e © 2020 Energy and Environmental Economics, Inc. Nova Scotia Power IRP Final Report Appendix A Page 62 of 64

AI summary The text is a page from an IRP (Integrated Resource Plan) final report by Nova Scotia Power, likely containing technical or analytical content related to energy planning, though the specific content is not visible in the provided excerpt.

lose is not considered to be convertible into liquid fuels. These feedstocks are included in BTS but typically contain petroleum-based content so are excluded from the renewable biomass potential. 57 P a g e © 2020 Energy and Environmental...

AI summary The text discusses the exclusion of certain feedstocks from renewable biomass potential due to their petroleum-based content, despite being included in the Billion Ton Study. This exclusion is relevant to the Integrated Resource Plan (IRP) of Nova Scotia Power.

57 P a g e © 2020 Energy and Environmental Economics, Inc. Nova Scotia Power IRP Final Report Appendix A Page 63 of 64

AI summary The document is a page from an appendix of the Nova Scotia Power Integrated Resource Plan (IRP) Final Report, published by Energy and Environmental Economics, Inc. It appears to be part of a regulatory proceeding related to energy planning and resource management.

is 11.576 221.65 Biomass to liquids refers to thermochemical conversion using gasification plus Fisher-Tropsch synthesis of drop-in synthetic fuels. 58 P a g e © 2020 Energy and Environmental Economics, Inc. Nova Scotia Power IRP Final Rep...

AI summary The document provides references to datasets and reports used in the 2020 Integrated Resource Plan (IRP) final assumptions set, including sources from Environmental and Climate Change Canada, Natural Resources Canada, and Navigant Consulting, Inc. for the US Energy Information Administration.

2020 INTEGRATED RESOURCE PLAN (IRP): FINAL ASSUMPTIONS SET MARCH 11, 2020 Nova Scotia Power IRP Final Report Appendix B Page 2 of 112 INTRODUCTION • The following materials represent the final Input Assumptions to be used in the 2020 IRP M...

AI summary The document outlines the final input assumptions for the 2020 Integrated Resource Plan (IRP) modeling by Nova Scotia Power. It mentions stakeholder engagement through workshops and updates to assumptions based on feedback. NS Power will proceed with the modeling phase and provide an interim update in April 2020.

Page 30 Distributed Energy Resources (DERs Page 41 Planning Reserve Margin Page 46 Wind, Solar, Battery and Demand Response – Effective Page 50 Load Carrying Capacity (ELCC) DSM Page 58 Demand Response Page 62 Imports Page 70 Fuel Pricing...

AI summary The document outlines the 2020 Integrated Resource Plan (IRP) financial assumptions, including a weighted average cost of capital (WACC) of 6.62% pre-tax and 5.64% after-tax, an inflation rate of 2% based on the Conference Board of Canada CPI forecast, and revenue requirement profiles for supply-side options. The WACC was approved by the Utility and Review Board under matter M09498.

will be developed outside of the model using E3’s Pro Forma financial model Utility and Review Board M09498 – Approval of pre-tax WACC/AFUDC rate for both capital and non-capital matters 2020 IRP FINAL ASSUMPTIONS SET 4 Nova Scotia Power I...

AI summary The document discusses the 2020 Integrated Resource Plan (IRP) assumptions, including load forecasts based on NS Power’s annual report and the PATHWAYS electrification scenarios. It also references the application of demand-side management (DSM) scenarios from E1’s Potential Study and the inclusion of a 'No New DSM' scenario for calculating avoided costs.

arios from E1’s Potential Study are then applied to these modified loads; there is also a “No New DSM” scenario which is required for calculating the Avoided Cost of Demand Side Management. 2020 IRP FINAL ASSUMPTIONS SET 7 Nova Scotia Powe...

AI summary The document outlines the assumptions used in the 2020 Integrated Resource Plan (IRP) Final Assumptions Set, including economic forecasts, EV penetration, and demand-side management (DSM) scenarios. It details how DSM scenarios are subtracted from a 'no new DSM' forecast and includes various factors such as efficiency initiatives, consumer behavior, and technological developments.

ct • Consumer behaviour and investments • Energy efficiency codes and standards • Initiatives undertaken by other agencies • Technological and market developments. 2020 IRP FINAL ASSUMPTIONS SET 9 Nova Scotia Power IRP Final Report Appendi...

AI summary Nova Scotia Power has developed Integrated Resource Plan (IRP) load forecasts by integrating four data sources, including demand-side management (DSM) potential and PATHWAYS load drivers. The forecasts are paired with scenarios from the Initial Portfolio Study Phase and aim to align with the Sustainable Development Goals Act (SDGA) targets.

the Sustainable Development Goals Act (SDGA) targets. • Load shape will be based on 2018 actuals; forecast shapes will need to be evaluated to ensure reasonableness and adjusted if necessary. 2020 IRP FINAL ASSUMPTIONS SET 10 Nova Scotia P...

AI summary The document outlines the assumptions used in the 2020 Integrated Resource Plan (IRP) final report, including load shape based on 2018 actuals and the development of annual energy load scenarios for analysis in the IRP modeling phase.

ANNUAL ENERGY • The following load scenarios (annual energy) have been developed for analysis in the IRP modeling phase, in order to test a meaningful range of potential future outcomes.

AI summary The document outlines the development of load scenarios for annual energy analysis as part of the Integrated Resource Plan (IRP) modeling phase to evaluate a range of potential future outcomes.

2020 IRP FINAL ASSUMPTIONS SET 11 Nova Scotia Power IRP Final Report Appendix B Page 13 of 112 IRP LOAD FORECAST SCENARIOS ANNUAL ENERGY Low Range High Range - BAU - No New Mid E. High DER. Mid E - Max Ach. High E/High DER. High E - Max Ye...

AI summary The document presents load forecast scenarios from Nova Scotia Power's 2020 Integrated Resource Plan (IRP), showing energy demand projections across various scenarios, including base case, mid and high energy efficiency, and demand response assumptions.

13,829 2041 8,848 11,003 11,525 13,681 11,730 12,563 10,102 11,513 11,770 13,086 12,870 13,920 2042 8,877 11,053 11,572 13,801 11,819 12,643 10,159 11,608 11,854 13,209 12,999 14,033 2043 8,905 11,104 11,619 13,919 11,905 12,718 10,211 11,...

AI summary The text presents numerical data and load forecast scenarios for Nova Scotia Power's Integrated Resource Plan (IRP), including assumptions related to electrification impact and demand-side management (DSM) potential.

FIRM PEAK • The following load scenarios (firm peak demand) have been developed for analysis in the IRP modeling phase, in order to test a meaningful range of potential future outcomes. 2020 IRP FINAL ASSUMPTIONS SET 13 Nova Scotia Power I...

AI summary The document outlines various load scenarios, specifically firm peak demand, developed for the Integrated Resource Plan (IRP) modeling phase. These scenarios include different assumptions such as BAU (business as usual), Mid E, High E, and varying levels of demand response (DER) and energy efficiency (DSM) to analyze potential future outcomes.

3,043 3,088 2,994 3,189 2039 2,089 2,178 2,277 2,644 2,447 2,494 2,494 2,636 3,073 3,114 3,026 3,214 2040 2,105 2,191 2,289 2,670 2,468 2,515 2,515 2,653 3,099 3,138 3,053 3,237 2041 2,119 2,202 2,299 2,694 2,487 2,532 2,533 2,667 3,121 3,...

AI summary The document contains numerical data related to energy planning scenarios and references the 2020 Integrated Resource Plan (IRP) Final Assumptions Set. It includes abbreviations like High/Mid E and Max Ach. which relate to electrification impact and demand-side management potential.

ge 27 of 112 FORECAST NO X EMISSION HARD CAPS NOx Emission Hard Caps 16 14 12 10 8 NOx Limit 6 4 2 0 2020 IRP FINAL ASSUMPTIONS SET 26 Nova Scotia Power IRP Final Report Appendix B Page 28 of 112 FORECAST SO 2 EMISSION HARD CAPS SO2 Emissi...

AI summary The document presents emission hard caps for NOx, SO2, and Mercury, based on the 2020 Integrated Resource Plan (IRP) and previous assumptions from the 2014 IRP. It outlines a trajectory of declining emissions, particularly for CO2, as part of future scenarios.

ion Hard Caps 50 45 40 35 30 25 Hg Limit 20 15 10 5 0 Air Quality Regulations outline requirements for mercury diversion program and stipulates NS Power can use credits for compliance from 2020 to 2029. The hard caps for 2020 to 2029 assum...

AI summary The text discusses Nova Scotia Power's assumptions related to mercury diversion programs, renewable energy regulations requiring 40% renewable energy by 2020, and the impact of carbon caps and net-zero policies on renewable energy outcomes. It also references the 2020 Integrated Resource Plan (IRP) and its assumptions.

2020 IRP FINAL ASSUMPTIONS SET 30 Nova Scotia Power IRP Final Report Appendix B Page 32 of 112 SUPPLY SIDE OPTIONS OVERVIEW • The original draft assumptions for the costs of new bulk grid scale resources (capital costs and fixed and variab...

AI summary The document outlines the 2020 Integrated Resource Plan (IRP) Final Assumptions Set, including updates to supply-side options based on new data sources and modeling approaches, such as sensitivity analysis for capital costs.

12 Resource options study approach 34 Approach Nova Scotia Power IRP Final Report Appendix B Page 35 of 112  In preparation for its upcoming integrated resource plan, NS Power has asked E3 to provide guidance on resource costs and potenti...

AI summary NS Power is preparing its Integrated Resource Plan (IRP) and has engaged E3 to assess resource options, focusing on costs, performance, and potential development within Nova Scotia. The study includes modeling resource costs, operational constraints, and long-term planning tools to evaluate generation portfolios.

Reciprocating Engine $27 $9 Nuclear Small modular reactor $140 $0 All O&M costs assumed to escalate at 2% per year. 39 Nova Scotia Power IRP Final Report Appendix B Page 41 of 112 NS POWER CAPITAL COST SENSITIVITIES • For certain resource...

AI summary The text discusses NS Power's approach to modeling capital cost sensitivities for various energy resources, including wind, solar, and battery storage, with different base and low-case capital costs. This is done to assess the impact on resource additions in the capacity expansion model, considering potential lower capital costs or alternative financing structures.

i-Ion $2,125 $1,835 (4 hr) Solar $1,800 $1,515 2020 IRP FINAL ASSUMPTIONS SET 40 Nova Scotia Power IRP Final Report Appendix B Page 42 of 112 2020 IRP: DISTRIBUTED ENERGY RESOURCES (DER s) MARCH 11, 2020 2020 IRP FINAL ASSUMPTIONS SET 41 N...

AI summary The document discusses the challenges of evaluating the impact of distributed energy resources (DERs) on the electricity system, including system-level and distribution-level costs and benefits, the influence of incentives and policy goals, and the limitations of capacity optimization models in capturing locational value.

around these resources. • Capacity optimization models (as employed in the IRP) may not be granular enough to capture cost/benefits, particularly locational value. 2020 IRP FINAL ASSUMPTIONS SET 42 Nova Scotia Power IRP Final Report Append...

AI summary The text discusses the limitations of capacity optimization models used in the Integrated Resource Plan (IRP), particularly their inability to capture the locational value of distributed energy resources (DERs). The 2020 IRP includes scenarios with mandatory DERs to ensure their consideration, even if not economically selected. Costs and benefits of DERs are evaluated separately in the resource portfolio.

$250.00 Capital Cost Decline Trajectory ($2020) 2020$ Levelized Cost of Energy (LCOE) $3,500.00 $200.00 $3,000.00 $2,500.00 $150.00 $/kW

AI summary The document presents a capital cost decline trajectory and levelized cost of energy (LCOE) data for the year 2020, illustrating financial considerations related to energy generation and infrastructure planning.

$1,000 $500 2020 2022 2024 2026 2028 2030 2032 2034 2036 2038 2040 2042 2044 2020 IRP FINAL ASSUMPTIONS SET 45 Nova Scotia Power IRP Final Report Appendix B Page 47 of 112 2020 IRP: PLANNING RESERVE MARGIN MARCH 11, 2020 2020 IRP FINAL ASS...

AI summary Nova Scotia Power engaged E3 to conduct a Planning Reserve Margin (PRM) and capacity value study, updating assumptions for the Integrated Resource Plan (IRP) process. The study ensures resource adequacy, reliability, and affordability of power supply by evaluating load characteristics and resource availability.

en calculate what quantity of planning reserves are required to achieve that reliability target. Planning Reserve Margin and Capacity Value Study, Energy + Environmental Economics, July 2019 2020 IRP FINAL ASSUMPTIONS SET 47 Nova Scotia Po...

AI summary The document discusses the Planning Reserve Margin (PRM) required by Nova Scotia Power to achieve a 0.1 days/year loss of load expectation (LOLE) target. It states that a PRM range of 17.8% to 21.0% is needed, with 20% being the base case assumption.

will maintain its existing PRM of 20% as the base case assumption and iterate on portfolios to determine specific PRM requirements as illustrated in the Analysis Plan overview. 2020 IRP FINAL ASSUMPTIONS SET 48 Nova Scotia Power IRP Final...

AI summary Nova Scotia Power will maintain a 20% Planning Reserve Margin (PRM) as the base case assumption in the 2020 Integrated Resource Plan (IRP). The PRM will be calculated using the Unforced Capacity (UCAP) method, and Effective Load Carrying Capacity (ELCC) will be used for valuing thermal, hydro, and renewable resources. The Reliability and Operability Assessment phase will ensure a 0.1 Days/year Loss of Load Expectation (LOLE) metric is met.

2020 IRP FINAL ASSUMPTIONS SET 50 Nova Scotia Power IRP Final Report Appendix B Page 52 of 112 EFFECTIVE LOAD CARRYING CAPABILITY (ELCC) • The information from the Planning Reserve Margin and Capacity Value Study undertaken by E3 as part o...

AI summary The document discusses the Effective Load Carrying Capability (ELCC) of wind energy in Nova Scotia Power's system, referencing a study by E3. It notes that the average ELCC of existing wind capacity is 19%, while the marginal ELCC of adding new wind is 11%, indicating diminishing returns as more wind capacity is added.

ults, DR exhibits diminishing average and marginal ELCC values. The ELCC of a DR program will depend on its specific characteristics. NS Power’s Marginal DR ELCC 2020 IRP FINAL ASSUMPTIONS SET 55 Nova Scotia Power IRP Final Report Appendix...

AI summary The document discusses the Effective Load Carrying Capacity (ELCC) of Demand Response (DR) programs, noting that DR exhibits diminishing average and marginal ELCC values. It also explores how combinations of renewable energy and storage can enhance ELCC through synergies, with specific examples of solar and wind paired with storage. A study from July 2019 is referenced.

ELCC Diversity Benefit of Wind + Storage Planning Reserve Margin and Capacity Value Study, Nova Scotia Power, July 2019, Energy + Environmental Economics 2020 IRP FINAL ASSUMPTIONS SET 57 Nova Scotia Power IRP Final Report Appendix B Page...

AI summary The 2020 Integrated Resource Plan (IRP) includes four Demand-Side Management (DSM) scenarios (Base, Low, Mid, Max Achievable) that are subtracted from the 'no new DSM' forecast. The DSM amounts for 2021-2022 are based on the 2020-2022 DSM supply agreement, with remaining years held constant on an incremental basis. The scenarios include a range of energy efficiency activities, such as cost-effective electricity efficiency, consumer behavior, and energy efficiency codes.

59 Nova Scotia Power IRP Final Report Appendix B Page 61 of 112 ENERGY EFFICIENCY (EE) Data Provided by E1 in 2019 Potential Study 2020 IRP FINAL ASSUMPTIONS SET 60 Nova Scotia Power IRP Final Report Appendix B Page 62 of 112 DSM PEAK REDU...

AI summary The document discusses Nova Scotia Power's 2020 Integrated Resource Plan (IRP) assumptions, focusing on demand response (DR) programs and energy efficiency (EE) data provided by E1 in the 2019 Potential Study. DR programs are modeled as a resource option for the 25-year period from 2021 to 2045.

ppendix B Page 66 of 112 E1 DR TOTAL ACHIEVABLE POTENTIAL • All DR Programs from the 2019 DSM Potential Study are aggregated. • DR program costs as per E1 Potential Study. 2020 IRP FINAL ASSUMPTIONS SET 65 Nova Scotia Power IRP Final Repor...

AI summary This section outlines the aggregation of all DR programs from the 2019 DSM Potential Study and summarizes DR options from Nova Scotia Power's 2020 Integrated Resource Plan, including peak shaving potential, customer incentives, participation scenarios, and program costs over a 25-year period.

cost covered by NS potential defined number of Power and funding system peak events where available. 2020 IRP FINAL ASSUMPTIONS SET 66 Nova Scotia Power IRP Final Report Appendix B Page 68 of 112 DR OPTIONS SUMMARY (NS POWER) CONT. Water H...

AI summary The text discusses the cost and enrollment of water heater demand response (DR) programs under Nova Scotia Power's 2020 Integrated Resource Plan (IRP). It includes visual data showing cumulative customer enrollment, cumulative program cost, and yearly program cost over a 26-year period.

4000 $50,000,000 3500 Enrolled Customer Count $40,000,000 3000 Program Cost 2500 $30,000,000 2000 $20,000,000 1500 1000 $10,000,000 500 $0 0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 Year, starting 2019 Cumula...

AI summary The text presents a graph showing cumulative customer enrollment and program cost over time, with a focus on the 2020 Integrated Resource Plan (IRP) final assumptions. It references the Nova Scotia Power IRP Final Report Appendix B and includes a date of March 11, 2020.

NAL ASSUMPTIONS SET 69 Nova Scotia Power IRP Final Report Appendix B Page 71 of 112 2020 IRP: IMPORTS MARCH 11, 2020 2020 IRP FINAL ASSUMPTIONS SET 70 Nova Scotia Power IRP Final Report Appendix B Page 72 of 112 SUMMARY – IMPORTS • Firm im...

AI summary The 2020 Integrated Resource Plan (IRP) outlines assumptions regarding imports, including firm and non-firm transmission options. Firm imports could support lower GHG emissions and replace coal-fired generation, requiring firm transmission via existing or new infrastructure. Non-firm imports can use existing or new transmission but may be subject to curtailment.

up to ~450 MW. Non-Firm Import Options: • Import energy via existing transmission (Maritime Link and New Brunswick tieline); and/or • Import energy via new transmission. 2020 IRP FINAL ASSUMPTIONS SET 72 Nova Scotia Power IRP Final Report...

AI summary The document discusses enabling transmission investment, outlining qualitative and quantitative benefits, including enhanced system reliability, renewable integration, and economic energy imports. It also provides cost estimates for new transmission projects, such as the 345kV Onslow-Salisbury-Coleson Cove and the HVDC to QC line.

Onslow-Salisbury-Coleson Cove $600M 700 345kV Onslow-Salisbury ; HVDC to QC 2 $1.7B 1000 • Assumptions presented here would be subject to additional feasibility study if selected during the IRP modeling. • The transmission costs above are...

AI summary The text outlines transmission project costs, assumptions for the Integrated Resource Plan (IRP), and pricing for firm imports, including capacity and energy provision based on Platts Analytics forecasts and emissions accounting standards. The projects are subject to feasibility studies and cost-sharing opportunities.

FINAL ASSUMPTIONS SET 75 Nova Scotia Power IRP Final Report Appendix B Page 77 of 112 2020 IRP: FUEL PRICING MARCH 11, 2020 2020 IRP FINAL ASSUMPTIONS SET 76 Nova Scotia Power IRP Final Report Appendix B Page 78 of 112 SERVICE PROVIDERS •...

AI summary The document outlines the 2020 Integrated Resource Plan (IRP) assumptions for fuel pricing, specifically for coal and petcoke, developed by Energy Ventures Analysis (EVA). The forecasting approach includes adjustments based on transportation costs and market insights from third-party providers.

Appendix B Page 80 of 112 FUNDAMENTAL PRICE FORECASTS – COAL & PETCOKE - EVA Commodity Highlights Provider • Continued decline in demand for coal in the US and Europe as coal Energy Ventures power plants and other sources of coal demand ar...

AI summary This section discusses the future price forecasts for coal and petcoke, highlighting declining demand in the US and Europe, strong demand in Asia, and the role of petcoke in cement kilns and power generation. It also references the 2020 Integrated Resource Plan (IRP) Final Assumptions Set.

IRP FINAL ASSUMPTIONS SET 79 Nova Scotia Power IRP Final Report Appendix B Page 81 of 112 FUNDAMENTAL PRICE FORECASTS Delivered = Commodity + Transportation Price Base Case – Coal = Coal + Ocean Freight Source: EVA (1Q2020) Source: CSL Fre...

AI summary The document presents fundamental price forecasts for coal and petcoke, including commodity and transportation costs, sourced from EVA and NS Power contracts. It also outlines fuel pricing assumptions for natural gas as part of the 2020 Integrated Resource Plan (IRP) final assumptions set.

lanning Service Quarterly Update (Brent) InterContinental Exchange (ICE) DEC 2019 2020 IRP FINAL ASSUMPTIONS SET 82 Nova Scotia Power IRP Final Report Appendix B Page 84 of 112 NATURAL GAS OPTIONS - SUMMARY • NS Power’s 2020 IRP will evalu...

AI summary Nova Scotia Power's 2020 Integrated Resource Plan (IRP) evaluates natural gas units as potential replacements for aging coal plants, considering economic and policy factors. Natural gas is highlighted for its flexibility, efficiency, and role in backing up renewable energy, though permitting challenges for fossil-fuel infrastructure must be addressed.

ially during the extremes when wind and solar could be at a minimum. • Permitting must be considered when evaluating fossil-fuel based infrastructure modification/reinforcement/expansion. 2020 IRP FINAL ASSUMPTIONS SET 83 Nova Scotia Power...

AI summary The document discusses the challenges and uncertainties associated with natural gas options in Nova Scotia's Integrated Resource Plan (IRP). Key considerations include the uncertainty of natural gas prices, supply constraints, and the need for reliable gas supply sources to support new gas plants during peak winter demand.

d that consider existing supply arrangements and compare and contrast possible new paths to move gas to Nova Scotia for possible new gas units as represented in the system optimization. 2020 IRP FINAL ASSUMPTIONS SET 85 Nova Scotia Power I...

AI summary The document outlines three natural gas supply options for Nova Scotia Power's 2020 Integrated Resource Plan (IRP), including existing gas, peaking gas, and base loaded gas, with different pricing scenarios considered for each option.

RP FINAL ASSUMPTIONS SET 86 F U N DA M E NTA L N AT U R A L G A S S C E NA R I O S Nova Scotia Power IRP Final Report Appendix B Page 88 of 112

AI summary The text introduces the 'Fundamental Natural Gas Scenarios' section of Nova Scotia Power's Integrated Resource Plan (IRP) Final Report Appendix B, which outlines key assumptions and scenarios related to natural gas use.

• LNG exports from the US face stiffer offshore competition • More anti-fossil fuel sentiment limits electric and industrial demand growth 2020 IRP FINAL ASSUMPTIONS SET 87 Nova Scotia Power IRP Final Report Appendix B Page 89 of 112 NS CA...

AI summary The document outlines assumptions related to natural gas in the 2020 Integrated Resource Plan (IRP) final report, including existing and new gas supply contracts, pricing models, and volume considerations for different gas types.

new pipelines/paths. Operational & Reliability Phase will evaluate whether actual volumes are consistent with how the pricing was developed which considered volumes. Existing Gas is volume limited.

AI summary The text discusses the evaluation of actual gas volumes against pricing models during the Operational & Reliability Phase, noting that existing gas infrastructure is volume limited.

2020 IRP FINAL ASSUMPTIONS SET 88 Nova Scotia Power IRP Final Report Appendix B Page 90 of 112 NATURAL GAS – EXISTING GAS (TCPL NBJ 20,000 MMBTU/DAY) Delivered = Commodity + Basis + Transportation + Market Price Premium Base = Henry Hub +...

AI summary The document outlines the assumptions for the 2020 Integrated Resource Plan (IRP) regarding natural gas, including the components of delivered price and the sources used for modeling. It references different cases (Base, Low, High) and includes details on transportation costs and modeling assumptions.

atts Analytics negotiated Tolls (4Q2019) (June 2019) Reference, Low or Reference, Low or High Case High Case 2020 IRP FINAL ASSUMPTIONS SET 90 Nova Scotia Power IRP Final Report Appendix B Page 92 of 112 NATURAL GAS – BASELOAD Delivered =...

AI summary The text discusses the components of natural gas delivered price, including commodity, basis, transportation tolls, and market premium. It references the 2020 Integrated Resource Plan (IRP) Final Assumptions Set and provides details on the base and low case scenarios for natural gas pricing, with tolls modeled as fixed costs and fuel usage as variable costs.

cs (4Q2019) Platts Analytics Cove modelled as variable Low Case (June 2019) costs High = Henry Hub + AECO + Tolls Nova to Tufts Cove + Nil modelled as fixed costs Source: Global Platts Source: Global Fuel & Usage Nova to Tufts Analytics (4...

AI summary The document discusses alternative natural gas supply arrangements for Nova Scotia Power's Integrated Resource Plan (IRP), including dual fuel capability, natural gas storage, and LNG alternatives. These options are not fully modeled in the current IRP but may be considered in more detailed analysis if new natural gas investments are indicated.

o oil or vice versa poses operational challenges and can jeopardize unit availability. • There are increased emissions associated with burning oil in lieu of natural gas for fuel assurance. • Oil refill during the peak heating season has p...

AI summary The text outlines challenges associated with dual fuel capability, including increased emissions, compliance costs, and permitting issues. It also mentions the development of a natural gas storage facility by AltaGas in Nova Scotia and the potential for NS Power to contract for storage capacity if new gas units are included in the IRP recommendation.

he amount of turns and resultant withdrawal rates, etc.) • As per the Dual Fuel Capability option, NS Power will study this option in detail if new gas units are part of the IRP recommendation 2020 IRP FINAL ASSUMPTIONS SET 97 Nova Scotia...

AI summary The document discusses the 2020 Integrated Resource Plan (IRP) assumptions, including the study of dual fuel capability and the impact of high utilization factors on sustaining capital costs for coal units. LNG alternatives are also explored as a method of gas delivery.

peration in order to appropriately compare economics. • High sustaining capital cost sensitivities will assume the following: • High (or other iterative ranges) = Base + 50% 2020 IRP FINAL ASSUMPTIONS SET 100 Nova Scotia Power IRP Final Re...

AI summary The document discusses the 2020 Integrated Resource Plan (IRP) Final Assumptions Set, including sustaining capital forecasts for thermal, combustion turbine, and small hydro assets. It outlines the screening process for economic retirements of hydro and combustion turbine fleets, considering decommissioning and replacement costs, and how these will be evaluated in Portfolio Studies and Operability/Reliability Screening.

be considered in the Portfolio Studies and Operability/Reliability Screening; this will assess provision of essential grid services and other system characteristics not modeled in RESOLVE. 2020 IRP FINAL ASSUMPTIONS SET 104 Nova Scotia Pow...

AI summary The 2020 Integrated Resource Plan (IRP) outlines the transformation of the electric utility sector over the next 25 years, emphasizing the shift towards decarbonization and the retirement of coal-fired generators. This transition will impact system adequacy and the provision of essential grid services traditionally provided by synchronous machines.

RP FINAL ASSUMPTIONS SET 106 Nova Scotia Power IRP Final Report Appendix B Page 108 of 112 SUMMARY (CONT.) • For IRP modeling, assumptions about cost and operational constraints to address these services will be considered. The assumptions...

AI summary The document outlines assumptions for the Integrated Resource Plan (IRP) modeling, focusing on grid services required to accommodate inverter-based generation. Key grid services include ramping reserve, system strength, Volt-Ampere-Reactive support, and synchronous inertia. These will be modeled as dynamic constraints to ensure stable system operation with renewable resources.

essential grid services will be represented in the model as dynamic constraints, which will enable the model to integrate renewable resources at any level by ensuring provision of the services. 2020 IRP FINAL ASSUMPTIONS SET 108 Nova Scoti...

AI summary The document discusses the need for additional ramping and regulation reserves due to increased variability from renewable energy and coal unit retirements. It references a stability study that outlines the relationship between inverter-based generation and ramping reserve requirements, and presents an interconnection option to support renewable integration.

s to integrate an additional 400 MW of inverter-based generation, represented by a wind as a proxy. • Interconnection Option : A second 345 kV AC tie between Onslow NS and Salisbury NB. • Local mitigation Option : A 200 MVA Synchronous Con...

AI summary The document discusses options for integrating renewable energy into the Nova Scotia Power grid, including the installation of synchronous condensers, switched capacitor banks, and a 345 kV AC tie. It also outlines the costs and technical requirements for these integration measures.

capacity or additional energy markets. 1) High Inertia - High inertia SC designs fitted with flywheels can provide inertia constants of ~5 MW.sec/MVA 2020 IRP FINAL ASSUMPTIONS SET 111 Nova Scotia Power IRP Final Report Appendix C Page 1 o...

AI summary The 2020 Integrated Resource Plan (IRP) modeling process involves resource screening to refine candidate resources for each scenario, using both qualitative evaluation and quantitative modeling with E3’s RESOLVE model.

able to model in each scenario (this may differ by scenario). Combination of qualitative evaluation and/or quantitative modeling using E3’s RESOLVE model. Initial Portfolio Conduct capacity expansion optimization modeling with Plexos LT St...

AI summary The document outlines the methodology for evaluating resource portfolios and scenarios in Nova Scotia Power's Integrated Resource Plan (IRP). It includes capacity expansion optimization modeling using Plexos and E3’s RESOLVE model, reliability screening with E3’s RECAP model, and operability screening using Plexos MT/ST to assess production costs and dispatch constraints.

reening phases, if Study required, conduct revised capacity expansion optimization modeling with Plexos (supplemented with E3’s RESOLVE model where required). Sensitivity Analysis Using bookend values, as identified for each scenario, test...

AI summary NS Power is using a Portfolio Development approach to create the 2020 IRP Scenarios, evaluating a range of potential futures and developing a Roadmap and Action Plan based on the least regrets options common to the largest number of scenarios. Key policy drivers are identified to form the basis of these scenarios.

folio Study phase is illustrated in Figure 3. Figure 3 - IRP Portfolio Study Modeling Approach KEY POLICY DRIVERS NS Power is proposing three key policy drivers to form the basis of scenarios: 1. Provincial clean energy policy (e.g. Sustai...

AI summary NS Power proposes three key policy drivers for the Integrated Resource Plan, including provincial clean energy policy focusing on greenhouse gas emissions and load changes due to electrification, as well as federal clean energy policy related to coal unit end dates. Three GHG scenarios are outlined to reflect potential outcomes of provincial carbon policy.

Nova Scotia Power IRP Final Report Appendix C Page 6 of 12 2020 Integrated Resource Plan Scenarios & Modeling Plan March 11, 2020 1.2 Load Changes This driver represents the impact provincial greenhouse gas reduction and/or “net zero” poli...

AI summary The 2020 Integrated Resource Plan (IRP) discusses load changes driven by provincial greenhouse gas reduction policies, such as the Sustainable Development Goals Act (SDGA), and evaluates three load scenarios: business as usual, moderate electrification, and high electrification. These scenarios consider the impact of electrification on the electricity sector based on E3's Pathways assessment.

eflect E1’s 2019 DSM Potential Study profiles to reflect potential demand side resources). 2. Federal Clean Energy Policy Drivers 2.1 Coal Closure Policy The two states of this driver are: • All coal units retired by 2040 – assumes retenti...

AI summary The document discusses E1’s 2019 DSM Potential Study and outlines federal clean energy policy drivers, specifically coal closure policies with two scenarios: retiring all coal units by 2040 or 2030. It also mentions the Integrated Resource Plan (IRP) model and scenario screening, resulting in 18 potential candidate scenarios.

Moderate Electrification 2040 Accelerated Net Zero 2045 Business as Usual 2040 Table 3 - Potential Candidate Scenarios Qualitative screening was used to identify six key scenarios of interest (highlighted in Table 4 in green) and to elimin...

AI summary The document outlines potential candidate scenarios for electrification and decarbonization, including 'Moderate Electrification 2040' and 'Accelerated Net Zero 2045', and references the 2020 Integrated Resource Plan (IRP) and E3’s Pathways Report. Higher load levels are associated with larger carbon budgets, reflecting broader economic decarbonization.

Nova Scotia Power IRP Final Report Appendix C Page 8 of 12 2020 Integrated Resource Plan Scenarios & Modeling Plan March 11, 2020 GHG Scenario Load Driver Coal End Date Comparator GHG Case High Electrification 2030 Comparator GHG Case Mode...

AI summary The document outlines various scenarios considered in the 2020 Integrated Resource Plan (IRP) by Nova Scotia Power, including different greenhouse gas (GHG) scenarios, electrification levels, and coal phase-out dates, with a focus on achieving net zero emissions by 2050 or earlier.

Zero 2045 Moderate Electrification 2040 Accelerated Net Zero 2045 Business as Usual 2040 Table 4 – Scenarios of Interest RESOURCE STRATEGIES Three resource strategies are proposed to ensure the IRP analysis covers key areas of importance a...

AI summary The document outlines three resource strategies for the Integrated Resource Plan (IRP) analysis: Current Landscape, Distributed Resources, and Regional Integration. It also presents scenarios with different policy drivers and resource strategies, including associated load forecasts and sensitivities.

C - Regional Integration • No New Emitting Net Zero 2050 from 2030 to 0.5Mt High Electrification in 2050 3.1 GHG targets Mid Elec. 2030 B - Distributed Resources • DSM Levels decline from 2025 Base DSM C - Regional Integration • No New Emi...

AI summary The document outlines key scenarios for the 2020 Integrated Resource Plan, focusing on GHG reduction targets and electrification levels. It mentions the use of modeling tools like Plexos LT and E3’s RESOLVE model for scenario analysis and sensitivity evaluations.

Consistent with the scenario screening discussed above, additional scenarios may be tested using E3’s RESOLVE model to assess if they should be included as a key modeling run. SENSITIVITY ANALYSES Following completion of the portfolio stud...

AI summary NS Power will conduct sensitivity analyses using E3’s RESOLVE model to test various scenarios, including changes in renewable energy standards, fuel prices, and resource availability, as part of the Integrated Resource Plan (IRP) modeling process. These analyses will help prioritize sensitivities and assess their impact on resource portfolios.

criteria against which potential plans and resource portfolios will evaluated under each scenario, as shown in Table 6 below: Metric Description Minimization of the cumulative present value of 25 year NPV Revenue Requirement the annual rev...

AI summary The document outlines criteria for evaluating potential plans and resource portfolios under different scenarios, including minimizing revenue requirements, reliability requirements, grid services, plan robustness, emissions reduction, and flexibility. These metrics are detailed in Table 6.

tion of constraints on future Qualitative assessment of timing of decisions arising from the selection of a particular investments path) Table 6 - Resource Plan Evaluation Criteria While the primary metric of plan value will continue to be...

AI summary The 2020 Integrated Resource Plan (IRP) outlines policy drivers such as provincial clean energy goals, greenhouse gas emissions reduction, and federal coal unit closure timelines. These drivers form the basis for various scenarios, including Net Zero 2050 and Accelerated Net Zero 2045, with different levels of electrification and coal closure dates.

2045 / High Electrification / 2030 Coal Closure The potential resource strategies, to be paired with scenarios to influence the constraints around portfolios, also emerged from scenario discussions: A - Current Landscape B - Distributed Re...

AI summary The document outlines various scenarios and resource strategies for achieving different greenhouse gas (GHG) reduction targets by 2030 and 2050, including current landscape, distributed resources promotion, and regional integration. These strategies are paired with electrification levels and demand-side management (DSM) approaches to form preliminary portfolio combinations for modeling.

Annual rate changes are calculated as the change in the rate year-over-year. A simple (i.e. non cumulative) average rate change is created by averaging rate changes over the analysis period. • The analysis employs a number of simplifying a...

AI summary The document discusses the methodology for calculating annual rate changes, including simplifying assumptions such as uniform FCR distribution and proportional load changes from electrification. It also mentions updates to model inputs and parameters, including the assumption of $0/MWh additional FCR and the use of a 'system average' rate estimate.

Rate (cents/kWh) 15.71 15.78 16.32 15.96 16.10 16.14 16.20 16.27 16.35 16.80 17.00 16.83 16.76 17.02 17.29 17.51 17.40 17.72 17.94 17.95 18.57 19.09 18.89 19.10 19.04 19.18 2.0C - Low Elec / Base DSM 2040 Coal Annual Rate Change 0.4% 3.4%...

AI summary The text presents a timeline of electricity rates and annual rate changes from 2020 to 2045, alongside the Integrated Resource Plan (IRP) revenue requirement for the Electrification Scenario 2. It includes figures for rate changes and revenue requirements in millions of dollars.

Rate (cents/kWh) 15.71 15.74 16.29 15.91 16.06 16.12 16.23 16.39 16.41 16.79 16.96 16.77 16.92 17.03 17.28 17.42 17.40 17.39 17.60 17.78 18.37 18.84 18.59 18.84 18.81 19.03 2.1C - Mid Elec / Base DSM 2040 Coal Annual Rate Change 0.2% 3.5%...

AI summary The text provides a table showing rate changes over time and revenue requirements for the Integrated Resource Plan (IRP) across multiple years, highlighting fluctuations in both rates and revenue. The data spans from 2020 to 2045, with a focus on the impact of electrification scenarios and planning periods.

Rate (cents/kWh) 15.71 16.90 17.48 17.36 17.35 17.43 17.54 17.66 17.69 17.97 18.16 17.95 17.81 18.02 18.12 18.28 18.21 18.47 18.70 18.71 19.39 19.75 19.56 19.71 19.80 19.93 2.2C - High Elec / Max DSM 2040 Coal Annual Rate Change 7.6% 3.4%...

AI summary The text presents rate data and revenue requirements over multiple years, showing fluctuations in rates and revenue from the Integrated Resource Plan (IRP). It highlights changes in annual rates and the partial revenue requirement for the IRP, indicating planning and financial considerations for the electricity sector.

Nova Scotia Power IRP Final Report Appendix D Page 3 of 3

AI summary This text refers to the Nova Scotia Power Integrated Resource Plan (IRP) Final Report Appendix D, Page 3 of 3. It is part of a regulatory proceeding document, likely related to energy planning and resource management in Nova Scotia.

2026 2027 2028 2029 2030 2031 2032 2033 2034 2035 2036 2037 2038 2039 2040 2041 2042 2043 2044 2045 2.0C - Low Elec / Base DSM 2040 Coal 2.1C - Mid Elec / Base DSM 2040 Coal 2.1B - Mid Elec / Base DSM w/ DER 2040 Coal 3.1C - Mid Elec / Bas...

AI summary The document presents updated modeling results from Nova Scotia Power's 2020 Integrated Resource Plan (IRP), including various scenarios for electricity generation and demand-side management (DSM) up to the year 2045. It outlines different pathways for coal-based electricity generation and DSM strategies.

D N O V E M B E R 2 7 , 2 0 2 0 Nova Scotia Power IRP Final Report Appendix E Page 2 of 72 REVISIONS SEPTEMBER 11 • Scenario 2.0C – corrected a typo in the 25-yr NPVRR (was previously reported as $12,224 – corrected to $12,234) • Updated o...

AI summary The document outlines revisions made to the Integrated Resource Plan (IRP) Final Report Appendix E, including corrections to NPV results, updates to CO2 emissions metrics, additions of new sensitivity runs, and adjustments to slide titles and rate model metrics for clarity and consistency.

ios 2.2A and 2.2C (indicated Base DSM, corrected to Max DSM) • Updated rate model metric title for clarity and consistency with IRP Final Report (replaced “partial rate” with “relative rate”) I R P U P D AT E D M O D E L I N G R E S U LT S...

AI summary The document discusses updates to the Integrated Resource Plan (IRP) modeling results, including changes to DSM metrics, revised rate model titles, and the presentation of final portfolio study results from PLEXOS simulations. It highlights scenario results, energy mix, capacity installation, emissions compliance, and partial NPV of revenue requirements.

costs (i.e. production, O&M, abatement, sustaining capital, and capital investment) and specific costs considered outside of the long-term model optimization (e.g. energy efficiency costs) I R P U P D AT E D M O D E L I N G R E S U LT S –...

AI summary The document outlines the metrics used to evaluate portfolios in the Integrated Resource Plan (IRP) final report, focusing on minimizing the cumulative present value of annual revenue requirements over a 25-year planning horizon, including adjustments for end-effects.

horizon. Flexibility (limitation of constraints on future decisions arising from the selection of Qualitative assessment of timing of investments a particular path) I R P U P D AT E D M O D E L I N G R E S U LT S – 2 0 2 0 - 1 1 - 2 7 6 No...

AI summary The text discusses the Integrated Resource Plan (IRP) update modeling results, including scenario metrics such as 25-year NPVRR and the replacement of coal capacity with new gas CCGT and CT units in the late 2030s, as well as the construction of the Reliability Tie enabling additional wind generation in 2035.

ffects ($MM) $16,431 Essential Grid Services • Essential Grid Service requirements are met as modeled 10-yr NPVRR ($MM) $6,805 Resource Adequacy & PRM • Reliability Tie: 2035 • Regional Integration: n/a Average Annual Relative Rate Impact...

AI summary The document outlines key metrics from Nova Scotia Power's Integrated Resource Plan (IRP), including financial effects, CO2 emissions, and scenario evaluations. It highlights the Essential Grid Services, Resource Adequacy, and Plan Robustness, while noting non-compliance with the Sustainable Development Goals Act and increased exposure to natural gas prices.

1.0C L O W E L E C . / B A S E D S M / C O M PA R AT O R E M I S S I O N S / R E G I O N A L I N T E G R AT I O N Scenario Metrics & Evaluation 25-yr NPVRR ($MM) $12,032 General Notes • Incremental firm imports enable an economic coal unit...

AI summary The document presents scenario metrics and evaluation for a 25-year Net Present Value Rate of Return (NPVRR) of $12,032 million, with considerations for coal unit retirements, reliability tie implementation in 2030, and regional interconnection construction in 2039. It highlights CO2 emissions reductions and mentions non-compliance with Sustainable Development Goals Act.

10 Nova Scotia Power IRP Final Report Appendix E Page 12 of 72 2.0A LOW ELEC. / BASE DSM / NET ZERO 2050 / CURRENT LANDSCAPE 11 Nova Scotia Power IRP Final Report Appendix E Page 13 of 72 2.0A LOW ELEC. / BASE DSM / NET ZERO 2050 / CURRENT...

AI summary The document presents scenario metrics and evaluation from Nova Scotia Power's Integrated Resource Plan (IRP) Final Report, including net present value of resource requirements (NPVRR), reliability tie construction, CO2 emissions, and grid service considerations over a 25-year period.

C capacity in 2040s 2021-2045 (%) 1.0% Total CO2 Emissions 2021-2030 (MT) 44.5 Total CO2 Emissions 2031-2045 (MT) 33.2 Total CO2 Emissions 2021-2045 (MT) 77.7 12 Nova Scotia Power IRP Final Report Appendix E Page 14 of 72 2.0C L O W E L E...

AI summary The text presents capacity and CO2 emissions projections for the 2021-2045 period, along with scenario metrics and evaluation from Nova Scotia Power's Integrated Resource Plan (IRP) Final Report. It includes NPVRR values for different scenarios and notes on grid services and reliability.

Resource Adequacy & PRM 10-yr NPVRR ($MM) $6,776 • Reliability Tie: 2030 • Regional Integration: 2037 Plan Robustness & Flexibility Average Annual Relative Rate Impact • Regional Integration provides flexible ability to meet emissions cons...

AI summary The document discusses the Integrated Resource Plan (IRP) from Nova Scotia Power, focusing on resource adequacy, Plan Robustness & Flexibility, and CO2 emissions projections from 2021 to 2045. It highlights the reliability tie in 2030 and regional integration in 2037, as well as the average annual relative rate impact and total CO2 emissions.

otia Power IRP Final Report Appendix E Page 17 of 72 2.1A MID ELEC. / BASE DSM / NET ZERO 2050 / CURRENT LANDSCAPE Scenario Metrics & Evaluation 25-yr NPVRR ($MM) $13,195 General Notes • Reliability Tie built in 2031 enables wind integrati...

AI summary The document presents scenario metrics and evaluation from Nova Scotia Power's Integrated Resource Plan (IRP) Final Report. It includes net present value of resource recovery (NPVRR) figures, reliability tie construction, gas capacity transitions, and CO2 emissions data for different time periods.

16 Nova Scotia Power IRP Final Report Appendix E Page 18 of 72 2.1B MID ELEC. / BASE DSM / NET ZERO 2050 / DISTRIBUTED RESOURCES 17 Nova Scotia Power IRP Final Report Appendix E Page 19 of 72 2.1B MID ELEC. / BASE DSM / NET ZERO 2050 / DIS...

AI summary The document presents scenario metrics and evaluation from Nova Scotia Power's Integrated Resource Plan (IRP) Final Report. It includes 25-yr and 10-yr Net Present Value of Resource Recovery (NPVRR) figures, CO2 emissions projections, and notes on DER modeling, grid reliability, and emissions constraints.

gration provides flexible ability to meet emissions constraints Total CO2 Emissions 2021-2030 (MT) 37.9 Total CO2 Emissions 2031-2045 (MT) 23.8 Total CO2 Emissions 2021-2045 (MT) 61.7 18 Nova Scotia Power IRP Final Report Appendix E Page 2...

AI summary The text provides CO2 emissions data for Nova Scotia Power from 2021 to 2045 and references the Integrated Resource Plan (IRP) and regional integration as part of a scenario evaluation process.

21 of 72 2.1C M I D E L E C . / B A S E D S M / N E T Z E R O 2 0 5 0 / R E G I O N A L I N T E G R AT I O N Scenario Metrics & Evaluation 25-yr NPVRR ($MM) $12,983 General Notes • Reliability Tie built in 2031 (earlier than previous runs)...

AI summary The document presents scenario metrics and evaluation for a 25-year Net Present Value Rate of Return (NPVRR) of $12,983 MM, with adjustments for end effects and considerations for reliability, resource adequacy, and emissions reduction targets under the Integrated Resource Plan (IRP). It includes details on coal unit retirements, grid services, and CO2 emissions.

20 Nova Scotia Power IRP Final Report Appendix E Page 22 of 72 2.2A HIGH ELEC. / MAX DSM / NET ZERO 2050 / CURRENT LANDSCAPE 21 Nova Scotia Power IRP Final Report Appendix E Page 23 of 72 2.2A HIGH ELEC. / MAX DSM / NET ZERO 2050 / CURRENT...

AI summary The document presents scenario metrics and evaluation from Nova Scotia Power's Integrated Resource Plan (IRP) Final Report. Key points include a 25-year Net Present Value of Resource Recovery (NPVRR) of $15,448 million, with additional considerations such as early load growth, reliability tie construction, and wind integration. A 25-year NPVRR with end effects is $21,301 million, including the conversion of coal units to gas in 2037. Essential Grid Services requirements are met as modeled.

nverted to gas in 2037 Essential Grid Services 10-yr NPVRR ($MM) $8,166 • Essential Grid Service requirements are met as modeled Resource Adequacy & PRM • Reliability Tie: 2030 Average Annual Relative Rate Impact • Regional Integration: n/...

AI summary The document discusses the Essential Grid Services, Resource Adequacy & PRM, and Plan Robustness & Flexibility under the Integrated Resource Plan (IRP) for Nova Scotia Power. It highlights CO2 emissions, reliance on natural gas, and the impact of gas conversion builds on supply flexibility.

Page 25 of 72 2.2C H I G H E L E C . / M A X D S M / N E T Z E R O 2 0 5 0 / R E G I O N A L I N T E G R AT I O N Scenario Metrics & Evaluation 25-yr NPVRR ($MM) $15,172 General Notes • Reliability Tie & Regional Interconnection built in 2...

AI summary The text presents scenario metrics and evaluation data from an Integrated Resource Plan (IRP) by Nova Scotia Power, including Net Present Value of Resource Recovery (NPVRR), carbon emissions, and grid reliability considerations. The scenarios consider coal-to-gas conversions, regional interconnection, and demand-side management strategies.

25 Nova Scotia Power IRP Final Report Appendix E Page 27 of 72 3.1B MID ELEC. / BASE DSM / ACCEL. NET ZERO 2045 / DISTRIBUTED RESOURCES Scenario Metrics & Evaluation 25-yr NPVRR ($MM) $12,540 General Notes • DER is modeled as a load reduct...

AI summary The document presents scenario metrics and evaluation from Nova Scotia Power's Integrated Resource Plan (IRP) Final Report, focusing on mid-electricity, base DSM, accelerated net zero 2045, and distributed resources. It includes 25-yr and 10-yr NPVRR figures, CO2 emissions data, and mentions grid reliability and resource adequacy measures.

egration provides flexible ability to meet emissions constraints Total CO2 Emissions 2021-2030 (MT) 35.8 Total CO2 Emissions 2031-2045 (MT) 8.8 Total CO2 Emissions 2021-2045 (MT) 44.7 26 Nova Scotia Power IRP Final Report Appendix E Page 2...

AI summary The document outlines emission reduction targets and scenarios for Nova Scotia Power, including total CO2 emissions from 2021 to 2045, and discusses the Integrated Resource Plan (IRP) and regional integration strategies for achieving net zero by 2045.

72 3.1C M I D E L E C . / B A S E D S M / A C C E L . N E T Z E R O 2 0 4 5 / R E G I O N A L I N T E G R AT I O N Scenario Metrics & Evaluation 25-yr NPVRR ($MM) $13,576 General Notes • 1 coal to gas conversion in 2030 • Regional Intercon...

AI summary The document presents scenario metrics and evaluation data for two different Integrated Resource Plan (IRP) scenarios, focusing on Net Present Value of Resource Recovery (NPVRR), CO2 emissions, and grid reliability. Key elements include coal-to-gas conversion, regional interconnection, and solar energy deployment.

28 Nova Scotia Power IRP Final Report Appendix E Page 30 of 72 3.2B HIGH ELEC. / MAX DSM / ACCEL. NET ZERO 2045 / DISTRIBUTED RESOURCES 29 Nova Scotia Power IRP Final Report Appendix E Page 31 of 72 3.2B HIGH ELEC. / MAX DSM / ACCEL. NET Z...

AI summary This section presents the financial and environmental metrics for the Integrated Resource Plan (IRP) under the HIGH ELEC. / MAX DSM / ACCEL. NET ZERO 2045 / DISTRIBUTED RESOURCES scenario. It includes Net Present Value of Resource Recovery (NPVRR), carbon emissions, and reliability considerations such as the Reliability Tie and Regional Integration.

egration provides flexible ability to meet emissions constraints Total CO2 Emissions 2021-2030 (MT) 33.8 Total CO2 Emissions 2031-2045 (MT) 10.2 Total CO2 Emissions 2021-2045 (MT) 44.0 30 Nova Scotia Power IRP Final Report Appendix E Page...

AI summary The document outlines a scenario focused on high electricity demand, maximum demand-side management, accelerated net-zero goals by 2045, and regional integration. It includes metrics and evaluations related to CO2 emissions from 2021 to 2045 and highlights the integration of energy strategies to meet emissions constraints.

3.2C H I G H E L E C . / M A X D S M / A C C E L . N E T Z E R O 2 0 4 5 / R E G I O N A L I N T E G R AT I O N Scenario Metrics & Evaluation 25-yr NPVRR ($MM) $15,841 General Notes • Gas CT builds and incremental firm imports support earl...

AI summary The text presents scenario metrics and evaluation from Nova Scotia Power's Integrated Resource Plan (IRP) Final Report, including 25-yr and 10-yr Net Present Value of Resource Recovery (NPVRR) figures, CO2 emissions projections, and sensitivity analysis results. Key points include the impact of gas infrastructure and imports on load growth, emissions reduction, and grid reliability.

ITY ANALYSIS RESULTS Nova Scotia Power IRP Final Report Appendix E Page 35 of 72

AI summary The document presents the results of an ITY analysis from Nova Scotia Power's Integrated Resource Plan (IRP) Final Report, specifically Appendix E, which is on page 35 of 72.

-1 High Import & Gas Prices I R P U P D AT E D M O D E L I N G R E S U LT S – 2 0 2 0 - 0 9 - 1 1 34 Nova Scotia Power IRP Final Report Appendix E Page 36 of 72 2.0A.DSM-1 (MID DSM) LOW ELEC. / MID DSM / NET ZERO 2050 / CURRENT LANDSCAPE N...

AI summary The document discusses the impact of Mid DSM on the Integrated Resource Plan (IRP) modeling results, showing a reduction in CT resources due to lower peak load and increased capacity from DR programs, along with an increase in NPVRR across all time periods.

5-yr NPVRR w/ End Effects ($MM) $16,599 $16,347 • NPVRR is increased relative to Base DSM case for all three time periods Essential Grid Services 10-yr NPVRR ($MM) $7,145 $6,786 • No significant change relative to 2.0A Resource Adequacy &...

AI summary The document provides a comparison of 5-year and 10-year Net Present Value of Resource Recovery (NPVRR) figures, showing increases relative to the Base DSM case. It also outlines changes in CO2 emissions and mentions the Integrated Resource Plan (IRP) and Demand Side Management (DSM) scenarios.

G R AT I O N New Installed Capacity Comparison (2045) 2.1C.DSM-2 MW 37 Nova Scotia Power IRP Final Report Appendix E Page 39 of 72 2.1C.DSM- 2 (MID DSM) M I D E L E C . / M I D D S M / N E T Z E R O 2 0 5 0 / R E G I O N A L I N T E G R AT...

AI summary The text references a scenario metrics and evaluation section from Nova Scotia Power's Integrated Resource Plan (IRP) Final Report, focusing on demand-side management (DSM) and mid-level electricity scenarios, including a comparison of new installed capacity by 2045.

(MID DSM) M I D E L E C . / M I D D S M / N E T Z E R O 2 0 5 0 / R E G I O N A L I N T E G R AT I O N Scenario Metrics & Evaluation Sensitivity Base (2.1C) 25-yr NPVRR ($MM) $13,288 $12,983 General Notes • 1 coal unit is retired earlier t...

AI summary The document compares the 25-year and 10-year Net Present Value of Resource Recovery (NPVRR) under the Mid DSM scenario versus the Base (2.1C) scenario. The Mid DSM case involves retiring an additional gas steam unit by 2045 and replacing capacity through demand-side management, combustion turbine capacity, and demand response programs. The NPVRR is higher in the Mid DSM case, and there are no changes in essential grid services or reliability tie timelines.

dequacy & PRM 2021-2030 (%) 1.2% 0.8% • Reliability Tie: 2030 2021-2045 (%) 0.8% 0.8% • Regional Integration: 2031 Plan Robustness & Flexibility Total CO2 Emissions 2021-2030 (MT) 39.9 41.8 • No change relative to 2.1C Base Total CO2 Emiss...

AI summary The document outlines CO2 emissions projections and installed capacity comparisons for different scenarios under the Integrated Resource Plan (IRP) by Nova Scotia Power. It discusses emissions from 2021 to 2045 and evaluates the robustness and flexibility of the plan, including reliability tie and regional integration timelines.

$7,817 $8,135 to the change in DSM level • NPVRR is decreased relative to 2.2C Max DSM case for all three time periods Essential Grid Services Average Annual Relative Rate Impact • No significant change from 2.2C 2021-2030 (%) 1.1% 1.5% 20...

AI summary The text discusses changes in DSM levels and their impact on NPVRR, as well as CO2 emissions over different time periods. It references the Integrated Resource Plan (IRP) and mentions grid services, reliability tie, and regional integration timelines. The comparison of new installed capacity in 2045 is also highlighted.

G R AT I O N New Installed Capacity Comparison (2045) 2.0C.DSM-4 MW 41 Nova Scotia Power IRP Final Report Appendix E Page 43 of 72 2.0C.DSM- 4 (LOW DSM) L O W E L E C . / L O W D S M / N E T Z E R O 2 0 5 0 / R E G I O N A L I N T E G R AT...

AI summary This section presents a scenario analysis under the Low Electrification/Low DSM/Net Zero 2050/Regional Integration scenario, focusing on installed capacity and evaluating various metrics for the Integrated Resource Plan (IRP) of Nova Scotia Power.

642 $6,776 end effects are considered relative to 2.0C Base DSM indicating the solutions are very close economically Essential Grid Services Average Annual Relative Rate Impact • No change relative to 2.0C 2021-2030 (%) 0.4% 0.8% 2021-2045...

AI summary The document compares the economic and environmental impacts of different scenarios, including the 2.0C DSM-5 plan. It highlights minimal changes in average annual relative rate impact and reductions in CO2 emissions over time. The comparison also includes new installed capacity by 2045 under the 2.0C DSM-5 scenario.

43 Nova Scotia Power IRP Final Report Appendix E Page 45 of 72 2.0C.DSM- 5 (MID DSM) L O W E L E C . / M I D D S M / N E T Z E R O 2 0 5 0 / R E G I O N A L I N T E G R AT I O N Scenario Metrics & Evaluation Sensitivity Base (2.0C) 25-yr N...

AI summary The document presents scenario metrics for the 2.0C.DSM-5 (MID DSM) plan, highlighting a 25-year NPVRR of $12,376 million and a 10-year NPVRR of $7,111 million. The plan includes increased DSM, which defers Regional Integration to 2039 and avoids 45MW of gas generation capacity. There is no change in Essential Grid Services compared to the 2.0C base case.

time periods 10-yr NPVRR ($MM) $7,111 $6,776 Essential Grid Services • No change relative to 2.0C Resource Adequacy & PRM Average Annual Relative Rate Impact • Reliability Tie: 2030 2021-2030 (%) 1.2% 0.8% • Regional Integration: 2039 2021...

AI summary The document presents a comparison of 10-year NPVRR values, average annual relative rate impact, and CO2 emissions for different time periods and scenarios, including the 2.0C.DSM-6 plan, which focuses on maximizing demand-side management and achieving net zero by 2050.

45 Nova Scotia Power IRP Final Report Appendix E Page 47 of 72 2.0C.DSM- 6 (MAX DSM) L O W E L E C . / M A X D S M / N E T Z E R O 2 0 5 0 / R E G I O N A L I N T E G R AT I O N Scenario Metrics & Evaluation

AI summary This section of the Nova Scotia Power Integrated Resource Plan (IRP) Final Report discusses the 'Low Elec./Max DSM/Net Zero 2050/Regional Integration' scenario, focusing on scenario metrics and evaluation. It explores the integration of demand-side management (DSM) strategies and regional energy planning in achieving net zero emissions by 2050.

(MAX DSM) L O W E L E C . / M A X D S M / N E T Z E R O 2 0 5 0 / R E G I O N A L I N T E G R AT I O N Scenario Metrics & Evaluation Sensitivity Base (2.0C) 25-yr NPVRR ($MM) $12,858 $12,076 General Notes • Increased level of DSM deferred...

AI summary This document presents scenario metrics and evaluation for a DSM plan, showing increased NPVRR under different sensitivity scenarios. Key changes include deferred Reliability Tie to 2034, Regional Integration to 2040, and avoidance of 95MW of gas generation capacity. The average annual relative rate impact is also outlined for different time periods.

equacy & PRM 2021-2030 (%) 1.4% 0.8% • Reliability Tie: 2034 2021-2045 (%) 1.0% 0.8% • Regional Integration: 2040 Total CO2 Emissions 2021-2030 (MT) 38.4 40.7 Plan Robustness & Flexibility Total CO2 Emissions 2031-2045 (MT) 23.7 24.3 • No...

AI summary The text provides data on CO2 emissions and reliability tie timelines, as well as a comparison of new installed capacity in 2045. It references the Integrated Resource Plan (IRP) and mentions Regional Integration and Net Zero 2045 goals.

e time periods Essential Grid Services 10-yr NPVRR ($MM) $7,470 $7,179 • No change relative to 3.1C Resource Adequacy & PRM • Reliability Tie: 2029 Average Annual Relative Rate Impact • Regional Integration: 2030 2021-2030 (%) 1.9% 1.5% 20...

AI summary The document outlines essential grid services and resource adequacy considerations, including a 10-year NPVRR, reliability tie in 2029, and regional integration by 2030. It also compares new installed capacity under the 2.1C.WIND-1 scenario, with a focus on low wind cost assumptions and net-zero 2050 goals.

49 Nova Scotia Power IRP Final Report Appendix E Page 51 of 72 2.1C.WI ND-1 (LOW WIND COST) M I D E L E C . / B A S E D S M / N E T Z E R O 2 0 5 0 / R E G I O N A L I N T E G R AT I O N Scenario Metrics & Evaluation Sensitivity Base (2.1C)

AI summary This section of the Nova Scotia Power IRP Final Report discusses the 'Wind-1 (Low Wind Cost)' scenario under the 'Mid Elec. / Based DSM / Net Zero 2050 / Regional Integration' heading, focusing on scenario metrics and evaluation.

Essential Grid Services 0.7% 0.8% • No change relative to 2.1C Resource Adequacy & PRM Total CO2 Emissions 2021-2030 (MT) 30.5 41.8 • Reliability Tie: 2025 Total CO2 Emissions 2031-2045 (MT) 26.1 29.1 • Regional Integration: 2026 Total CO2...

AI summary The document discusses Essential Grid Services and outlines CO2 emissions projections from 2021 to 2045, highlighting the need for resource adequacy, reliability, and flexibility in the energy system. It also references the Integrated Resource Plan (IRP) and mentions considerations around wind capacity and energy imports.

51 Nova Scotia Power IRP Final Report Appendix E Page 53 of 72 2.1C.WI ND-2 (LOW WIND & BAT TERY COST) M I D E L E C . / B A S E D S M / N E T Z E R O 2 0 5 0 / R E G I O N A L I N T E G R AT I O N

AI summary This section of the Nova Scotia Power Integrated Resource Plan (IRP) Final Report discusses a scenario labeled 'Wind-2 (Low Wind & Battery Cost)' under the 'Mid Elec. / Based DSM / Net Zero 2050 / Regional Integration' category, likely analyzing energy generation and demand-side management strategies in a low wind and low battery cost context.

Nova Scotia Power IRP Final Report Appendix E Page 53 of 72 2.1C.WI ND-2 (LOW WIND & BAT TERY COST) M I D E L E C . / B A S E D S M / N E T Z E R O 2 0 5 0 / R E G I O N A L I N T E G R AT I O N

AI summary This section of the Nova Scotia Power Integrated Resource Plan (IRP) Final Report discusses a scenario involving low wind and battery costs, focusing on Mid-Elec, based DSM, net zero 2050, and regional integration.

Scenario Metrics & Evaluation Sensitivity Base (2.1C) 25-yr NPVRR ($MM) $12,928 $12,983 General Notes • In general, resource plan changes are similar to what is seen in 2.1C.WIND-1 sensitivity but more pronounced • Low wind and battery pri...

AI summary The document presents sensitivity analysis of a 25-year and 10-year Net Present Value of Resource Recovery (NPVRR) under different scenarios. It highlights changes in wind and battery prices, coal unit retirements, and CO2 emissions, with implications for the Integrated Resource Plan (IRP) and reliability tie integration.

2021-2030 (%) 0.7% 0.8% • NPVRR is reduced relative to 3.1C in two of three metrics, slightly higher in 10-yr NPV due 2021-2045 (%) 0.7% 0.8% to advancement of investment Essential Grid Services Total CO2 Emissions 2021-2030 (MT) 26.8 41.8...

AI summary The text discusses CO2 emissions projections and grid reliability considerations under different scenarios, including the impact of wind energy on grid inertia and the need for flexibility in energy imports. It also references the Integrated Resource Plan (IRP) and mentions reliability tie and regional integration timelines.

R AT I O N New Installed Capacity Comparison (2045) 2.1C.WIND-3 MW 53 Nova Scotia Power IRP Final Report Appendix E Page 55 of 72 2.1C.WI ND-3 (LOW INERTIA CONSTRAINT) M I D E L E C . / B A S E D S M / N E T Z E R O 2 0 5 0 / R E G I O N A...

AI summary The text presents a section from Nova Scotia Power's Integrated Resource Plan (IRP) Final Report, specifically Appendix E, which includes a comparison of new installed capacity in 2045, focusing on a low inertia constraint scenario under the '2.1C.WIND-3' category.

Nova Scotia Power IRP Final Report Appendix E Page 55 of 72 2.1C.WI ND-3 (LOW INERTIA CONSTRAINT) M I D E L E C . / B A S E D S M / N E T Z E R O 2 0 5 0 / R E G I O N A L I N T E G R AT I O N

AI summary The text references a section of Nova Scotia Power's Integrated Resource Plan (IRP) Final Report, specifically Appendix E, discussing a wind constraint related to low inertia, and mentions topics such as mid-level electricity, based demand-side management, net zero 2050, and regional integration.

Scenario Metrics & Evaluation Sensitivity Base (2.1C) 25-yr NPVRR ($MM) $12,901 $12,983 General Notes • Inertia constraint is lowered from base of 3266 MW.sec to 2200 MW.sec in all hours • Slight change to wind profile build is observed: •...

AI summary The document presents scenario metrics and evaluation results for a 25-year and 10-year NPVRR under a sensitivity scenario and base scenario (2.1C). Key changes include adjustments to inertia constraints, wind profile builds, and the timing of the Reliability Tie and wind build. The analysis indicates minimal impact on overall resource plan optimization.

overall resource plan optimization 2021-2030 (%) 0.7% 0.8% • Cost differences are small over all three NPV metrics 2021-2045 (%) 0.8% 0.8% Essential Grid Services • Current studies indicate that 2200MW.sec of online kinetic inertia is not...

AI summary The document discusses the optimization of the resource plan from 2021 to 2045, highlighting small cost differences across NPV metrics and the need for additional stability studies due to insufficient kinetic inertia. It also mentions CO2 emissions and reliability tie and regional integration timelines.

B A S E D S M / N E T Z E R O 2 0 5 0 / R E G I O N A L I N T E G R AT I O N New Installed Capacity Comparison (2045) 2.1C.WIND-4 MW 55 Nova Scotia Power IRP Final Report Appendix E Page 57 of 72 2.1C.WI ND-4 (NO INERTIA / NO INTEGRATI ON)...

AI summary The document presents a scenario analysis under the Integrated Resource Plan (IRP) Final Report, focusing on a wind energy installation scenario labeled '2.1C.WIND-4' with no inertia and no integration. It includes a comparison of new installed capacity by 2045 and scenario metrics and evaluation.

ent and replacement energy costs, NPVs incorporating MT/ST Production 10-yr NPVRR ($MM) $6,996 $7,022 Costs are not significantly lower than the base scenario 2.1C Essential Grid Services • This run is intended as a test case to understand...

AI summary The text discusses the financial and environmental impacts of different energy scenarios, including NPVRR, CO2 emissions, and grid reliability considerations. It highlights the importance of grid services, reliability tie, and regional integration in managing wind energy penetration and ensuring system flexibility.

lenging to operate under some conditions • The plan has retained flexibility of supply by adding the Regional Integration resource 56 Nova Scotia Power IRP Final Report Appendix E Page 58 of 72 2.1C.MERSEY (MERSEY HYDRO RETIRED) M I D E L...

AI summary The document discusses the Mersey Hydro project, which has been retired, and mentions the addition of the Regional Integration resource as part of the Integrated Resource Plan (IRP) to maintain supply flexibility. It includes a comparison of new installed capacity by 2045.

Nova Scotia Power IRP Final Report Appendix E Page 59 of 72 2.1C.MERSEY (MERSEY HYDRO RETIRED) M I D E L E C . / B A S E D S M / N E T Z E R O 2 0 5 0 / R E G I O N A L I N T E G R AT I O N

AI summary This section of the Nova Scotia Power IRP Final Report discusses the Mersey Hydro project, which has been retired, and includes topics such as mid-electricity, based DSM, net zero 2050, and regional integration.

Nova Scotia Power IRP Final Report Appendix E Page 61 of 72 2.1C.IMPORT- 1 (LIMITED NON-FIRM IMPORTS) M I D E L E C . / B A S E D S M / N E T Z E R O 2 0 5 0 / R E G I O N A L I N T E G R AT I O N Scenario Metrics & Evaluation Sensitivity...

AI summary The document discusses the impact of limited non-firm imports on the Integrated Resource Plan (IRP) of Nova Scotia Power. Sensitivity analyses show a reduction in non-firm imports leads to increased costs and changes in generation mix, including earlier wind development and additional natural gas combined cycle units.

• No change relative to 2.1C 2021-2030 (%) 1.1% 0.8% 2021-2045 (%) 0.8% 0.8% Resource Adequacy & PRM • Reliability Tie: 2024 Total CO2 Emissions 2021-2030 (MT) 43.5 41.8 • Regional Integration: 2026 Total CO2 Emissions 2031-2045 (MT) 35.1...

AI summary The document presents comparative data on CO2 emissions and resource adequacy for different timeframes and scenarios, including a reliability tie in 2024 and regional integration in 2026. It also includes a comparison of new installed capacity in 2045 under the 2.1C scenario.

SE DSM / NET ZERO 2050 / CURRENT LANDSCAPE Scenario Metrics & Evaluation Sensitivity Base (2.0A) 25-yr NPVRR ($MM) $12,470 $12,193 General Notes • Without the ability to build the Reliability Tie, wind is built via the local integration op...

AI summary The text presents scenario metrics and evaluation for a DSM plan under the Net Zero 2050 initiative, comparing base and sensitivity scenarios. Key findings include higher costs in the sensitivity scenario due to reliance on local integration options like batteries and synchronous condensers, as well as impacts on grid services and resource adequacy.

ce Adequacy & PRM 2021-2045 (%) 1.0% 1.0% • Reliability Tie: n/a • Regional Integration: n/a Total CO2 Emissions 2021-2030 (MT) 40.6 44.5 Plan Robustness & Flexibility Total CO2 Emissions 2031-2045 (MT) 36.2 33.2 • No change relative to 2....

AI summary The document discusses CO2 emissions projections from 2021 to 2045 and outlines a new installed capacity comparison for 2045. It also references a limited reliability tie inertia scenario under the Integrated Resource Plan (IRP) and mentions regional integration considerations.

cotia Power IRP Final Report Appendix E Page 65 of 72 2.1C.IMPORT- 3 (LIMITED RELIABILITY TIE INERTIA) M I D E L E C . / B A S E D S M / N E T Z E R O 2 0 5 0 / R E G I O N A L I N T E G R AT I O N Scenario Metrics & Evaluation Sensitivity...

AI summary This section of the Integrated Resource Plan (IRP) Final Report Appendix E evaluates the financial impact of a scenario where the Reliability Tie contributes only 50% of required system inertia. The 25-year Net Present Value of Resource Recovery (NPVRR) is slightly lower compared to the base scenario, and the generation mix remains largely unchanged.

,022 • Generation mix is generally unchanged from 2.1C on an annual basis • Costs are relatively close to 2.1C on all NPV metrics Essential Grid Services Average Annual Relative Rate Impact • No change from 2.1C 2021-2030 (%) 0.9% 0.8% 202...

AI summary The document compares generation mix, costs, and CO2 emissions between different scenarios (2.1C and CAPEX-1) from 2021 to 2045. It highlights that generation mix and costs are largely unchanged, while CO2 emissions increase slightly over time. The Integrated Resource Plan (IRP) is referenced, along with Essential Grid Services and Resource Adequacy & PRM.

2.1C Nova Scotia Power IRP Final Report Appendix E Page 67 of 72 2.1C.CAPEX-1 (HIGH SUSTAINI NG CAPEX) M I D E L E C . / B A S E D S M / N E T Z E R O 2 0 5 0 / R E G I O N A L I N T E G R AT I O N Scenario Metrics & Evaluation Sensitivity...

AI summary This section discusses the 'High Sustaining CAPEX' scenario under the Integrated Resource Plan (IRP) Final Report, focusing on metrics and evaluation for mid-level electricity, based DSM, net zero 2050, and regional integration.

• Reliability Tie: 2024 Total CO2 Emissions 2021-2030 (MT) 37.4 41.8 • Regional Integration: 2029 Total CO2 Emissions 2031-2045 (MT) 27.3 29.1 Total CO2 Emissions 2021-2045 (MT) 64.7 70.9 Plan Robustness & Flexibility • No significant chan...

AI summary The document presents a reliability tie timeline for 2024 and regional integration for 2029. It outlines projected CO2 emissions from 2021 to 2045, showing a slight increase, and mentions that the plan remains robust with no significant change from the 2.1C target. The section also includes a graph comparing new installed capacity under the 2.1C.CAPEX-2 scenario.

and wind builds are delayed in line with later coal unit retirement date 10-yr NPVRR ($MM) $6,887 $7,022 but final resource plan is essentially unchanged from 2.1C Essential Grid Services • No significant change from 2.1C Average Annual Re...

AI summary The Integrated Resource Plan (IRP) shows minimal changes in resource planning despite delays in wind builds and coal unit retirements. CO2 emissions are slightly reduced over the 2021-2045 period, and average annual rate impacts remain stable. The plan includes Essential Grid Services, Resource Adequacy, and PRM timelines, with no significant changes from the 2.1C version.

Nova Scotia Power IRP Final Report Appendix E Page 71 of 72 2.1C.PRI CES- 1 (HIGH IMPORT & GAS PRICES) M I D E L E C . / B A S E D S M / N E T Z E R O 2 0 5 0 / R E G I O N A L I N T E G R AT I O N Scenario Metrics & Evaluation

AI summary This section of the Nova Scotia Power Integrated Resource Plan (IRP) Final Report discusses Scenario Metrics & Evaluation under the 'Prices-1 (High Import & Gas Prices)' scenario, considering factors like Mid-Elec, Base DSM, Net Zero 2050, and Regional Integration.

e Impact 2021-2030 (%) 1.1% 0.8% Essential Grid Services 2021-2045 (%) 1.1% 0.8% • No significant change from 2.1C Resource Adequacy & PRM Total CO2 Emissions 2021-2030 (MT) 41.8 41.8 • Reliability Tie: 2029 Total CO2 Emissions 2031-2045 (...

AI summary The document outlines CO2 emissions projections for Nova Scotia Power from 2021 to 2045, showing minimal changes in emissions and grid reliability. It also includes release notes for data tables related to the Integrated Resource Plan (IRP) modeling results from PLEXOS simulations.

6 35 34 34 27 26 18 16 8 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 3.2C Emission Year 2021 2022 2023 2024 2025 2026 2027 2028 2029 2030 2031 2032 2033 2034 2035 2036 2037 2038 2039 2040 2041 2042 2043 2044 2045 CO2 (k tonnes) 5,039 4,246 4,213 4,250...

AI summary The text presents emission data for CO2, Hg, NOx, and SO2 from 2021 to 2045, showing a gradual decline in emissions over time. The data is part of an appendix in the Nova Scotia Power Integrated Resource Plan (IRP) Final Report, discussing emission sensitivities.

Nova Scotia Power IRP Final Report Appendix F Page 4 of 25 Sensitivities 2.0A.DSM-1 (Mid DSM) Emission Year 2021 2022 2023 2024 2025 2026 2027 2028 2029 2030 2031 2032 2033 2034 2035 2036 2037 2038 2039 2040 2041 2042 2043 2044 2045 CO2 (k...

AI summary The table presents emission sensitivities under the Mid DSM scenario in Nova Scotia Power's Integrated Resource Plan. It shows decreasing CO2, Hg, NOx, and SO2 emissions over time, with significant reductions by 2045.

33 34 33 24 26 26 25 22 20 20 20 20 20 15 15 15 15 15 0 0 0 0 0 0 2.1C.Import-3 (Limited Reliability Tie In Emission Year 2021 2022 2023 2024 2025 2026 2027 2028 2029 2030 2031 2032 2033 2034 2035 2036 2037 2038 2039 2040 2041 2042 2043 20...

AI summary The document presents emission data for various pollutants (CO2, Hg, NOx, SO2) across multiple years, indicating a gradual decline in emissions from 2021 to 2045. This data is part of the Integrated Resource Plan (IRP) Final Report by Nova Scotia Power.

35 34 34 28 26 26 26 26 20 19 16 14 13 13 14 14 15 15 0 0 0 0 0 0 2.1C.PRICES-1 (High Import & Gas Price Emission Year 2021 2022 2023 2024 2025 2026 2027 2028 2029 2030 2031 2032 2033 2034 2035 2036 2037 2038 2039 2040 2041 2042 2043 2044...

AI summary The text presents a table of annual emissions data for various pollutants (CO2, Hg, NOx, SO2) across multiple years, indicating a general trend of decreasing emissions over time. The table is part of an appendix in a final portfolio study by Nova Scotia Power, likely related to an Integrated Resource Plan (IRP).

Nova Scotia Power IRP Final Report Appendix F Page 7 of 25 Final Portfolio Study

AI summary The text references the Final Portfolio Study from Nova Scotia Power's Integrated Resource Plan (IRP) Final Report, Appendix F, Page 7 of 25. It does not provide detailed content but indicates the location of a study within a larger report.

10 10 10 10 0 0 0 0 0 Battery 4hr 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Installed Capacity Changes Nova Scotia Power IRP Final Report Appendix F Page 8 of 25

AI summary The text presents a table with data related to battery capacity and installed capacity changes, referencing the Nova Scotia Power IRP Final Report Appendix F, Page 8 of 25.

Nova Scotia Power IRP Final Report Appendix F Page 8 of 25

AI summary The text refers to Nova Scotia Power's Integrated Resource Plan (IRP) Final Report, specifically Appendix F, Page 8 of 25. It indicates a section of a regulatory document related to energy planning and resource allocation.

60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 93 114 147 179 147 Installed Capacity Changes Nova Scotia Power IRP Final Report Appendix F Page 9 of 25

AI summary The text provides a table and heading related to installed capacity changes, referencing Nova Scotia Power's Integrated Resource Plan (IRP) Final Report Appendix F, Page 9 of 25.

Nova Scotia Power IRP Final Report Appendix F Page 9 of 25

AI summary The document is a page from the Nova Scotia Power Integrated Resource Plan (IRP) Final Report Appendix F, which provides detailed information on energy planning and resource strategies.

10 10 10 10 10 10 10 10 10 Battery 4hr 0 0 0 0 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 23 59 92 124 138 Installed Capacity Changes Nova Scotia Power IRP Final Report Appendix F Page 10 of 25

AI summary The document presents a table showing installed capacity changes for a battery system over time, with data points indicating capacity increases from 0 to 14 and then to 23, 59, 92, 124, and 138. The table is part of Nova Scotia Power's Integrated Resource Plan (IRP) Final Report Appendix F.

Nova Scotia Power IRP Final Report Appendix F Page 10 of 25

AI summary The document is a page from the Nova Scotia Power Integrated Resource Plan (IRP) Final Report Appendix F, which outlines aspects of the company's resource planning and energy strategies. It provides detailed information relevant to the regulatory process and generation, grid, and resources.

10 10 10 10 10 10 10 10 10 10 Battery 4hr 0 0 0 0 114 114 114 114 114 114 114 114 114 114 114 114 114 114 144 186 203 214 246 278 191 Sensitivities

AI summary The text presents a table with data related to battery storage capacity over time, likely as part of a sensitivity analysis. The values indicate varying levels of battery output, potentially in relation to energy storage or grid planning.

20 20 20 20 20 10 10 0 0 0 Battery 4hr 0 0 0 0 12 12 12 12 12 12 12 12 12 12 20 20 20 20 20 20 20 20 20 20 8 Installed Capacity Changes Nova Scotia Power IRP Final Report Appendix F Page 11 of 25

AI summary The document presents a table showing installed capacity changes for Battery 4hr over various years, with values ranging from 0 to 20. It is part of Appendix F of the Nova Scotia Power Integrated Resource Plan Final Report.

Nova Scotia Power IRP Final Report Appendix F Page 11 of 25

AI summary This document is a page from the Nova Scotia Power Integrated Resource Plan Final Report, specifically Appendix F, page 11 of 25. It provides detailed information related to the planning and analysis of energy resources and infrastructure.

10 10 10 10 10 10 10 10 0 10 10 10 10 Battery 4hr 0 0 0 21 93 93 93 93 93 93 93 93 93 93 93 93 93 93 93 93 93 93 93 72 6 Installed Capacity Changes Nova Scotia Power IRP Final Report Appendix F Page 12 of 25

AI summary The text presents a table related to battery capacity and installed capacity changes, referencing Nova Scotia Power's Integrated Resource Plan (IRP) Final Report Appendix F, Page 12 of 25.

Nova Scotia Power IRP Final Report Appendix F Page 12 of 25

AI summary The text refers to Nova Scotia Power's Integrated Resource Plan (IRP) Final Report, specifically Appendix F on page 12 of 25. This section is part of a regulatory proceeding related to energy planning and resource management.

Nova Scotia Power IRP Final Report Appendix F Page 13 of 25

AI summary The text refers to an appendix in the Nova Scotia Power Integrated Resource Plan (IRP) Final Report, indicating it is part of a larger document discussing energy planning and resource strategies.

10 10 10 10 10 0 0 0 0 0 Battery 4hr 0 0 0 0 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 0 Installed Capacity Changes Nova Scotia Power IRP Final Report Appendix F Page 14 of 25

AI summary The document presents a table showing installed capacity changes, specifically for Battery 4hr, with data spanning multiple years. It is part of Nova Scotia Power's Integrated Resource Plan (IRP) Final Report Appendix F, which outlines changes in energy capacity over time.

Nova Scotia Power IRP Final Report Appendix F Page 14 of 25

AI summary The text is a page reference from an appendix of the Nova Scotia Power Integrated Resource Plan (IRP) Final Report, indicating the location within the document but providing no substantive content or discussion.

Nova Scotia Power IRP Final Report Appendix F Page 15 of 25 Final Portfolio Study

AI summary The document presents the Final Portfolio Study from Nova Scotia Power's Integrated Resource Plan (IRP) Final Report, Appendix F, on page 15 of 25. It outlines the energy generation and resource planning strategies considered in the final portfolio evaluation.

1.83 2.61 2.37 2.21 2.39 2.22 2.56 2.91 0.00 0.00 0.00 0.00 0.00 Firm Imports 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Annual Energy Balance Nova Scotia Power IRP Final Report Appendix F Page 16 of 25

AI summary This section presents numerical data related to energy imports and an annual energy balance, likely part of a report on Nova Scotia Power's integrated resource plan. The data includes figures for imports and a reference to an annual energy balance, which may be used for regulatory analysis and planning.

Nova Scotia Power IRP Final Report Appendix F Page 17 of 25

AI summary The text refers to an appendix in the Nova Scotia Power Integrated Resource Plan (IRP) Final Report, specifically page 17 of 25. It does not provide specific content or discussion points in the provided text.

Nova Scotia Power IRP Final Report Appendix F Page 18 of 25

AI summary The text references the Nova Scotia Power Integrated Resource Plan (IRP) Final Report Appendix F, Page 18 of 25, indicating it is part of a regulatory proceeding related to energy planning and resource allocation.

Nova Scotia Power IRP Final Report Appendix F Page 19 of 25

AI summary The text refers to a page in the Nova Scotia Power Integrated Resource Plan (IRP) Final Report, specifically Appendix F, Page 19 of 25. It does not provide specific content or discussion points.

Nova Scotia Power IRP Final Report Appendix F Page 20 of 25

AI summary The text references the Nova Scotia Power Integrated Resource Plan (IRP) Final Report Appendix F, Page 20 of 25, indicating it is part of a regulatory proceeding related to energy planning and resource management.

984 983 982 979 979 59 977 978 977 978 973 973 1,304 2,330 2,308 2,336 2,355 2,370 2,502 Annual Energy Balance Nova Scotia Power IRP Final Report Appendix F Page 21 of 25

AI summary The text presents a table of numerical data followed by a section titled 'Annual Energy Balance' from Nova Scotia Power's Integrated Resource Plan (IRP) Final Report Appendix F, Page 21 of 25.

Nova Scotia Power IRP Final Report Appendix F Page 21 of 25

AI summary The text refers to the Nova Scotia Power Integrated Resource Plan (IRP) Final Report Appendix F, specifically Page 21 of 25, indicating a portion of the document that is being analyzed as part of a regulatory proceeding.

Nova Scotia Power IRP Final Report Appendix F Page 22 of 25

AI summary The text refers to the Nova Scotia Power Integrated Resource Plan (IRP) Final Report, specifically Appendix F on page 22 of 25. It does not provide further details or discussion of topics, arguments, or entities.

0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Firm Imports 0 949 949 949 953 949 959 958 969 971 971 972 967 968 968 969 959 963 954 2,331 2,325 2,333 2,267 2,286 2,318 Annual Energy Balance Nova Scotia Power IRP Final Report Appendix F Page 23 of 25

AI summary The document presents a table of Firm Imports and includes a section titled 'Annual Energy Balance' from the Nova Scotia Power Integrated Resource Plan (IRP) Final Report Appendix F, Page 23 of 25.

Nova Scotia Power IRP Final Report Appendix F Page 23 of 25

AI summary The text references the Nova Scotia Power Integrated Resource Plan (IRP) Final Report, specifically Appendix F, Page 23 of 25. This section likely contains detailed analysis or data related to the IRP, though the content of the chunk itself is not provided.

AES 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Battery Generation 0.46 0.55 0.73 0.87 65.24 51.19 49.70 47.94 67.00 55.30 65.30 56.87 58.14 56.92 64.31 0.00 52.70 67.56 67.27 87.91 91.19 88.48 100.34 111.61 78.02 Firm Imports 0 0 0...

AI summary The document presents a table showing energy generation and imports for various sources, with a focus on Battery Generation. It is part of an IRP Final Report Appendix F, indicating a discussion around energy resources and planning in Nova Scotia.

Nova Scotia Power IRP Final Report Appendix F Page 24 of 25

AI summary The text references the Nova Scotia Power Integrated Resource Plan (IRP) Final Report, specifically Appendix F, Page 24 of 25. It does not provide additional details or arguments beyond the reference to the report.

0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Battery Generation 0.54 0.59 0.49 0.45 5.99 7.23 7.05 7.66 7.24 10.49 9.17 12.59 14.36 15.54 15.19 14.56 14.34 12.96 11.65 12.05 9.40 9.25 8.97 9.39 0.52 Firm Imports 0 950 955 966 974 978...

AI summary The document presents data on battery generation and firm imports over a period, as part of the Integrated Resource Plan (IRP) Final Report Appendix F. The numbers represent varying levels of energy generation and imports, likely illustrating trends or projections for Nova Scotia Power.

Nova Scotia Power IRP Final Report Appendix F Page 25 of 25

AI summary The text references the Nova Scotia Power IRP Final Report Appendix F, page 25 of 25, indicating the conclusion of the document. It does not provide further details or analysis.

0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Battery Generation 0.68 0.64 0.67 0.68 2.93 4.01 3.89 4.10 2.65 4.80 4.86 6.35 6.17 6.46 6.16 6.15 5.30 9.00 10.47 10.93 6.92 6.70 7.95 8.12 12.33 Firm Imports 0 951 954 954 977 973 974 976 972...

AI summary The document lists entities involved in the Integrated Resource Plan (IRP) process, including the Nova Scotia Utility and Review Board, its counsel, staff, and consultants from Bates White and Synapse Energy Economics. It also mentions participants who were engaged in the process and provided feedback.

e Solar Provider Group Christian Pollard Source Atlantic Barry Sonmor Spark Power Paul Pynn Stantec Michael Doucet Stantec Paul Sanford Stantec Praveen Rosario Stantec Wendy Warford Stantec Greg Oliver Sustainable Marine Energy (Canada) Lt...

AI summary The document outlines the Integrated Resource Plan (IRP) analysis process and modeling for Nova Scotia Power, including participant engagement, assumptions, and the draft analysis plan dated January 20, 2020. It also includes responses to comments and scenario modeling plans.

MODELING Reliability Screening Assumptions Resource Initial Portfolio Final Portfolio Sensitivity & Scenarios Screening Study Study Analysis Operability Screening POST-MODELING Long-term Strategy Extract findings (observations and Roadmap...

AI summary The document outlines a modeling process for a reliability screening study, involving assumptions, scenarios, and resource screening using E3’s RESOLVE model. It also references the 2020 Integrated Resource Plan (IRP) analysis plan and mentions the extraction of findings to develop long-term strategies and action plans.

date resources to be available to model in each scenario (this may differ by scenario). Screening Combination of qualitative evaluation and/or quantitative modeling using E3’s RESOLVE model. Initial Portfolio Conduct capacity expansion opt...

AI summary The document outlines an analysis plan for the 2020 Integrated Resource Plan (IRP), detailing steps such as initial portfolio modeling, reliability and operability screening, final portfolio study, and sensitivity analysis using various modeling tools like RESOLVE, Plexos LT, and RECAP.

2020 IRP ANALYSIS PLAN 2 Nova Scotia Power IRP Final Report Appendix H Page 5 of 321 P OT E N T I A L “ P O R T F O L I O S T U D Y ” S C E N A R I O DEVELOPMENT APPROACH Portfolios (“Resource Plans”) Scenarios Optimal plans based on each...

AI summary The document outlines a potential 'Portfolio Study' scenario development approach for the 2020 Integrated Resource Plan (IRP), focusing on different scenarios ('Possible Futures') based on major uncertainties and influencing factors. It includes a table with scenarios labeled A and B, each associated with different drivers.

3 Scenario A Driver 1 Scenario B X Driver 2 B1 B2 B3 C1 C2 C3 Scenario C Driver 3 D1 D2 D3 Scenario D Variations such as resource costs or focus Variations likely focused on on specific resource Sensitivity Analysis coal closure timing, ty...

AI summary The text outlines different scenarios and variations in an analysis plan for the 2020 Integrated Resource Plan (IRP), focusing on factors like coal closure timing, electricity load, carbon emission reduction levels, and resource costs. It also mentions sensitivity analysis to test the impact of changes in key assumptions on the cost of the plan.

Nova Scotia Power IRP Final Report Appendix H Page 6 of 321 PROPOSED EVALUATION CRITERIA Metric Description Minimization of the cumulative present value of 25 year NPV Revenue Requirement the annual revenue requirements over the planning h...

AI summary The document outlines proposed evaluation criteria for the 2020 Integrated Resource Plan (IRP), including metrics such as minimizing revenue requirements, reliability, grid services, plan robustness, emissions reduction, and flexibility. It also introduces a draft assumptions addendum for the IRP modeling process.

esent a preliminary working draft of the Input Assumptions to be used in the 2020 IRP Modeling. • These Draft Input Assumptions are being brought forward for discussion with stakeholders. • The details of these assumptions will continue to...

AI summary Nova Scotia Power is presenting a preliminary working draft of the input assumptions for the 2020 Integrated Resource Plan (IRP) modeling. These assumptions are subject to refinement based on stakeholder feedback and updated data sources, with the final version to be circulated on March 5, 2020.

om the updated Pre- IRP work. The full report also includes “Low” price sensitivities to be tested. • The assumptions for the cost of new distributed resources are in the following section. 2020 IRP ASSUMPTIONS SET 28 Nova Scotia Power IRP...

AI summary The document outlines updates to the 2020 Integrated Resource Plan (IRP) assumptions, including the cost of new distributed resources and the inclusion of 'Low' price sensitivities for testing. The NSPI Resource Options Study provides details on capital costs for renewables and storage.

ocating Engine (50 MW) $1,823 $1,823 0% Nuclear Small modular reactor (100 MW) $9,196 $8,641 -6% 36 5 Summary of Proposed Assumptions Operating Costs – All Technologies Nova Scotia Power IRP Final Report Appendix H Page 13 of 321

AI summary The text presents a comparison of capital costs for different energy technologies, including a 50 MW locating engine and a 100 MW small modular reactor, with the latter showing a 6% cost reduction. It references Nova Scotia Power's Integrated Resource Plan Final Report Appendix H.

Reciprocating Engine $27 $9 Nuclear Small modular reactor $140 $0 All O&M costs assumed to escalate at 2% per year. 37 6 Nova Scotia Power IRP Final Report Appendix H Page 14 of 321 FUNDAMENTAL PRICE FORECASTS Commodity Pricing Point Provi...

AI summary The document presents fundamental price forecasts and sustaining capital forecasts for various energy sources, including reciprocating engines, nuclear (small modular reactors), solid fuel, and small hydro. It references the 2020 Integrated Resource Plan (IRP) assumptions and includes details on O&M cost escalations and contract pricing for coal.

Scotia Power IRP Final Report Appendix H Page 17 of 321 SMALL HYDRO • The sustaining capital forecast for hydro assets are based on Q1 2020 Forecast (an update of the Hydro Asset Study). 2020 IRP ASSUMPTIONS SET 96 Nova Scotia Power IRP Fi...

AI summary The document discusses interconnection costs for new generation and storage resources in the context of Nova Scotia Power's Integrated Resource Plan (IRP). It highlights that these costs can vary significantly based on location and that the IRP provides directional insight rather than specific project decisions.

2020 IRP ASSUMPTIONS SET 101 Nova Scotia Power IRP Final Report Appendix H Page 19 of 321 2020 INTEGRATED RESOURCE PLAN (IRP): DRAFT ASSUMPTIONS SET JANUARY 20, 2020 Nova Scotia Power IRP Final Report Appendix H Page 20 of 321 INTRODUCTION...

AI summary This document outlines the preliminary working draft of input assumptions for the 2020 Integrated Resource Plan (IRP) modeling by Nova Scotia Power. The assumptions are being shared with stakeholders for discussion and will be refined based on feedback before being finalized and circulated on February 7, 2020.

n page TABLE OF CONTENTS number below to go to slide Financial Assumptions Page 03 Load Assumptions Page 06 Environmental Assumptions (Existing & Defined Policy) Page 12 New Supply Side Options Page 27 Distributed Energy Resources (DERs Pa...

AI summary The document outlines the financial assumptions for the 2020 Integrated Resource Plan (IRP) by Nova Scotia Power, providing context for planning and resource allocation in the energy sector.

2020 IRP ASSUMPTIONS SET 6 Nova Scotia Power IRP Final Report Appendix H Page 26 of 321 LOAD ASSUMPTIONS OVERVIEW • The underlying data for the “Base Load Forecast” is based on NSP’s annual Load Forecast Report, as filed with the UARB in 2...

AI summary The document outlines the load assumptions used in the 2020 Integrated Resource Plan (IRP) by Nova Scotia Power (NSP), including the base load forecast derived from the 2019 Load Forecast Report and the application of demand-side management (DSM) scenarios. It also discusses the potential impact of electrification driven by the Sustainable Development Goals Act.

2030 2031 2032 2033 2034 2035 2036 2037 2038 2039 2040 2041 2042 2043 2044 2045 DSM level Low Base Mid Max Achievable No DSM 2020 IRP ASSUMPTIONS SET 8 Nova Scotia Power IRP Final Report Appendix H Page 28 of 321 PEAK DEMAND FORECAST Firm...

AI summary The document presents demand-side management (DSM) levels and peak demand forecasts for Nova Scotia Power's Integrated Resource Plan (IRP). It includes assumptions for base load forecasts, such as economic forecasts, EV penetration estimates, and weather averages.

anada • EV penetration based on conservative estimate of Electric Mobility Canada’s growth model • EV includes estimate for peak mitigation • 10-year average used for normal weather 2020 IRP ASSUMPTIONS SET 10 DEMAND SIDE MANAGEMENT IN Nov...

AI summary The document discusses demand-side management (DSM) scenarios in the context of the 2020 Integrated Resource Plan (IRP) by Nova Scotia Power. It outlines assumptions for EV penetration, load scenarios, and environmental considerations based on existing policies and legislation, including regulations on carbon dioxide emissions from coal-fired generation.

quivalency agreement has been renewed from 2020- 2024 with agreement on future methodology from 2025-2040. • Nova Scotia’s equivalency agreements must meet evolving Federal requirements. 2020 IRP ASSUMPTIONS SET 16 FORECASTED CO2 EMISSION...

AI summary The document discusses Nova Scotia's equivalency agreements with federal requirements, the 2020 Integrated Resource Plan (IRP) assumptions, and the implementation of a cap-and-trade system under the Pricing Act. It outlines hard caps on CO2 emissions and regulations for the cap-and-trade program, including free allocations for NS Power.

ONS • Provincial regulations that require 40% renewable energy by 2020. • Stipulates that no more than 350,000 dry tonnes of primary forest biomass may be used annually to meet the standard. • NS Power does not anticipate future specific r...

AI summary The document outlines provincial regulations requiring 40% renewable energy by 2020, with a cap on primary forest biomass usage. Nova Scotia Power (NSP) does not expect future specific renewable energy standards, aiming instead to meet net-zero carbon emissions goals. The 2020 Integrated Resource Plan (IRP) assumptions include cost data from the E3 Resource Options Study and updates from late 2019 datasets.

SET 28 Nova Scotia Power IRP Final Report Appendix H Page 48 of 321 NSPI Resource Options Study Nova Scotia Power July 2019 Aaron Burdick, Sr. Consultant Charles Li, Consultant Sandy Hull, Sr. Consultant Zach Ming, Sr. Managing Consultant...

AI summary Nova Scotia Power (NSPI) commissioned E3 to conduct a resource options study to support its upcoming Integrated Resource Plan (IRP). The study focuses on evaluating resource costs, performance, and potential, including capital, O&M, and fuel costs, operational constraints, and the amount of each resource that can be developed in Nova Scotia or remotely.

32 Resource Options Considered Nova Scotia Power IRP Final Report Appendix H Page 52 of 321  Fossil fuels: coal-to-gas, coal-to-biomass , natural gas (CC, CT, reciprocating engine, CC w/ carbon capture and storage)  Renewables: biomass,...

AI summary The document outlines various resource options considered in Nova Scotia Power's Integrated Resource Plan (IRP), including fossil fuels, renewables, energy storage, and emerging technologies. It also describes the process for modeling resource costs, including capital, O&M, fuel prices, and financing assumptions, to forecast levelized costs for Nova Scotia Power from 2019 to 2050.

% Pumped Storage $2,700 $2,700 0% a Solar PV costs reported in $/kW-ac, reflecting an inverter loading ratio of 1.3 35 Summary of Proposed Assumptions Capital Costs (2 of 2) – Fossil and Nuclear Nova Scotia Power IRP Final Report Appendix...

AI summary The text provides capital and operating cost assumptions for various energy technologies, including fossil and nuclear options, as outlined in the Nova Scotia Power Integrated Resource Plan (IRP) Final Report. It details projected costs for coal-to-gas conversion, natural gas combined cycle with and without carbon capture, combustion turbines, reciprocating engines, and small modular nuclear reactors.

scalate at 2% per year. 37 Nova Scotia Power IRP Final Report Appendix H Page 57 of 321 2020 IRP: DISTRIBUTED ENERGY RESOURCES (DERs) JANUARY 20, 2020 2020 IRP ASSUMPTIONS SET 38 DISTRIBUTED ENERGY Nova Scotia Power IRP Final Report Append...

AI summary The 2020 Integrated Resource Plan (IRP) discusses the challenges of evaluating distributed energy resources (DERs) on the electricity system, including their costs and benefits, deployment by various entities, and the impact of policy goals and technological uncertainty on adoption.

IRP ASSUMPTIONS SET 39 DISTRIBUTED RESOURCES Nova Scotia Power IRP Final Report Appendix H Page 59 of 321 MODELING • Given the challenges with the scale of DERs vs the granularity of IRP modeling, these resources will be examined via scena...

AI summary The document discusses assumptions related to distributed resources (DERs) in the 2020 Integrated Resource Plan (IRP), including modeling approaches and cost trajectories for distributed solar. It outlines how DERs will be incorporated into the IRP, considering their scale and modeling constraints.

Degradation (%/year) 0.5% 0.5% 2020 IRP ASSUMPTIONS SET 41 BTM BAT TERY STORAGE : COST Nova Scotia Power IRP Final Report Appendix H Page 61 of 321 ASSUMPTIONS Input 1HR 4HR $/kW2019 $1021 $2533 FO&M ($/kW-Yr) $8.34 27.35 Financing Lifetim...

AI summary The document presents assumptions related to the cost and performance of battery storage systems, including initial costs, financing lifetime, annual warranty, and capital cost decline trajectory, as part of the 2020 Integrated Resource Plan (IRP) by Nova Scotia Power.

1 ELECTRIC VEHICLES (EV S ) • Currently, electric vehicle market share is low—across Canada penetration was about 2.2% of sales in 2018, with sales in Nova Scotia much lower, at 0.18%. • The pace of growth is difficult to predict and depen...

AI summary The text discusses the current low market share of electric vehicles (EVs) in Nova Scotia and Canada, challenges in predicting EV growth due to various factors, and the uncertainty in customer charging behavior. Nova Scotia Power proposes modeling different EV adoption scenarios to assess resource needs.

ption. • NS Power proposes to model bookended scenarios via load modifier approach to compare resource needs both under a baseline adoption forecast and a high electrification scenario. 2020 IRP ASSUMPTIONS SET 44 Nova Scotia Power IRP Fin...

AI summary Nova Scotia Power (NS Power) is proposing to model scenarios using a load modifier approach to compare resource needs under baseline and high electrification forecasts. The 2020 Integrated Resource Plan (IRP) includes a Planning Reserve Margin (PRM) and capacity value study conducted by E3 to ensure resource adequacy and reliability of power supply.

hen calculate what quantity of planning reserve are required to achieve that reliability target. Planning Reserve Margin and Capacity Value Study, Energy + Environmental Economics, July 2019 2020 IRP ASSUMPTIONS SET 46 PLANNING RESERVE MAR...

AI summary The document discusses the Planning Reserve Margin (PRM) and its role in achieving a reliability target of 0.1 days/year loss of load expectation (LOLE). Nova Scotia Power proposes maintaining a 20% PRM as the base case and iterating on portfolios to determine specific PRM requirements.

2020 IRP ASSUMPTIONS SET 48 EFFECTIVE LOAD CARRYING Nova Scotia Power IRP Final Report Appendix H Page 68 of 321 CAPABILITY (ELCC) • The information from the Planning Reserve Margin and Capacity Value Study undertaken by E3 as part of the...

AI summary The document discusses the Effective Load-Carrying Capability (ELCC) assumptions used in the 2020 Integrated Resource Plan (IRP) by Nova Scotia Power. It references a study by E3 and outlines the ELCC of existing and new wind capacity on the NSPI system, noting that the ELCC of new wind is lower than existing wind.

2020 IRP ASSUMPTIONS SET 50 Nova Scotia Power IRP Final Report Appendix H Page 70 of 321 ELCC OF SOLAR The NSPI system currently has a very small amount of solar capacity at only 1.7 MW which has an average and marginal ELCC of 5%. Solar h...

AI summary The document discusses the Effective Load-Carrying Capability (ELCC) of various resources, including solar, battery storage, and demand response, within the context of Nova Scotia Power's 2020 Integrated Resource Plan (IRP). It highlights the limited ELCC of solar due to poor correlation with peak load hours and the diminishing ELCC values for all resources as capacity increases.

ELCC values. The ELCC of a DR program will depend on its specific characteristics. NSPI’s Marginal DR ELCC 2020 IRP ASSUMPTIONS SET 53 Nova Scotia Power IRP Final Report Appendix H Page 73 of 321 2020 IRP: DSM JANUARY 2O, 2020 2020 IRP ASS...

AI summary The document discusses the use of Energy Efficiency (EE) data from E1's 2019 Potential Study in the 2020 Integrated Resource Plan (IRP). The data is used as a load modifier to represent decreased energy consumption due to improved efficiency. The assumptions include various factors such as cost-effective efficiency activities, initiatives under the Public Utilities Act, consumer behavior, and technological developments.

Nova Scotia Power IRP Final Report Appendix H Page 75 of 321 ENERGY EFFICIENCY (EE) Data Provided by EfficiencyOne(E1) in 2019 Potential Study 2020 IRP ASSUMPTIONS SET 56 Nova Scotia Power IRP Final Report Appendix H Page 76 of 321 DSM PEA...

AI summary The document discusses Nova Scotia Power's 2020 Integrated Resource Plan (IRP) assumptions related to energy efficiency (EE) and demand response (DR) programs. Data from EfficiencyOne (E1) is referenced, including a 2019 Potential Study, which outlines assumptions for DR programs over a 25-year period (2021-2045). The document notes that E1's data can be used as a load modifier or bundled resource option.

2020 IRP ASSUMPTIONS SET 59 DEMAND RESPONSE Nova (DR) Scotia Power IRP Final Report Appendix H Page 79 of 321 (CONT.) • The resource option approach would allow Plexos to optimize which DR options to select and requires additional details/...

AI summary The document discusses the integration of Demand Response (DR) into the 2020 Integrated Resource Plan (IRP) assumptions, highlighting the distinction between Load Management and Demand Management. It notes that the resource option approach requires detailed program breakdowns from EfficiencyOne (E1) and additional time for optimization by Plexos.

1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 Cumulative Customer Enrollment Cumulative Program Cost Yearly Program Cost 2020 IRP ASSUMPTIONS SET 63 DR OPTIONS SUMMARY (NS Nova Scotia Power IRP Final Report Appendix...

AI summary The text provides a summary of demand response (DR) program enrollment and costs under the 2020 Integrated Resource Plan (IRP) assumptions. It includes data on cumulative customer enrollment and yearly program costs for the Smart Charger DR program, highlighting the financial and participation aspects of the initiative.

60000 $40,000,000 50000 40000 $30,000,000 30000 $20,000,000 20000 $10,000,000 10000 $0 0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 Year, starting 2019 Cumulative Customer Enrollment Cumulative Program Cost ($)...

AI summary The document includes graphical data on cumulative customer enrollment and program costs related to demand response (DR) options, specifically focusing on residential battery DR enrollment and costs. It references the 2020 Integrated Resource Plan (IRP) assumptions and includes a page reference from Nova Scotia Power's IRP Final Report Appendix H.

4000 $50,000,000 3500 Enrolled Customer Count $40,000,000 3000 Program Cost 2500 $30,000,000 2000 $20,000,000 1500 1000 $10,000,000 500 $0 0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 Year, starting 2019 Cumula...

AI summary The document includes a graph showing program cost and enrolled customer count over time, with a note that the 2020 Integrated Resource Plan (IRP) assumptions are set. It references Nova Scotia Power's IRP Final Report, Appendix H, Page 85 of 321, and mentions imports on January 20, 2020.

2020 IRP ASSUMPTIONS SET 65 Nova Scotia Power IRP Final Report Appendix H Page 85 of 321 2020 IRP: IMPORTS JANUARY 20, 2020 2020 IRP ASSUMPTIONS SET 66 Nova Scotia Power IRP Final Report Appendix H Page 86 of 321 SUMMARY – FIRM IMPORTS • F...

AI summary The 2020 Integrated Resource Plan (IRP) outlines assumptions for firm and non-firm imports, noting that firm imports could support lower GHG emissions and coal replacement through regional interconnection. Firm transmission capacity is required for each option, either through existing or new transmission infrastructure, with firm imports ranging up to 150 MW via existing and 800 MW via new transmission.

2020 IRP ASSUMPTIONS SET 70 Nova Scotia Power IRP Final Report Appendix H Page 90 of 321 2020 IRP: FUEL PRICING JANUARY 20, 2020 2020 IRP ASSUMPTIONS SET 71 Nova Scotia Power IRP Final Report Appendix H Page 91 of 321 SERVICE PROVIDER S&P...

AI summary The 2020 Integrated Resource Plan (IRP) assumptions include fuel pricing forecasts provided by S&P Global Platts analytics, a long-time service provider to NSPI. The forecasts are adjusted for delivery to Nova Scotia based on transportation costs, market insights, and long-term market development scenarios.

Q4 2019 Scenario Planning Service Quarterly JKM (Asian Natural Gas) Update AECO Basis S&P Global Platts’ Analytics JUNE 2019 Dawn Basis (formerly PIRA Energy Group ) (LT) S&P Global Platts’ Analytics NOV 2019 (formerly PIRA Energy Group )...

AI summary Nova Scotia Power's 2020 Integrated Resource Plan (IRP) evaluates natural gas units as potential replacements for the aging coal fleet, considering economic and policy factors. Improvements in natural gas plant flexibility and efficiency are creating competitive advantages over coal, especially with the faster pace of grid operations driven by variable generation.

ave a firm source of gas supply to reliably generate power during winter peaks; • Operational Mode/utilization must be considered (i.e. primarily for capacity or for energy and capacity); • Three supply paths have been developed that consi...

AI summary The document discusses three natural gas supply options for Nova Scotia Power, including existing gas, peaking gas, and base-loaded gas, each with different capacity and cost assumptions. Scenarios for each option include base, high, and low cases.

2020 IRP ASSUMPTIONS SET 78 F U N DA M E N TA L N AT G A S S C E N A R I O S Nova Scotia Power IRP Final Report Appendix H Page 98 of 321

AI summary The document discusses the 2020 Integrated Resource Plan (IRP) assumptions and outlines fundamental natural gas scenarios as part of Nova Scotia Power's final report, specifically in Appendix H.

( S & P G LO BA L P L AT TS A N A LY T I C S ) H E N RY H U B Likelihood Highlights (S&P Global) Base Case 50% -US Demand growth expected to slow post 2020 (Expected) -Gas consumption in the power sector has become saturated -More location...

AI summary The text outlines S&P Global's analysis of US natural gas demand and supply scenarios from 2018 to 2030, highlighting factors influencing growth, such as environmental policies, LNG export capabilities, and regulatory developments. It also references the 2020 Integrated Resource Plan (IRP) assumptions.

-More anti-fossil fuel sentiment limits electric and industrial demand growth 2020 IRP ASSUMPTIONS SET 79 Nova Scotia Power IRP Final Report Appendix H Page 99 of 321 NS CASE DEVELOPMENT (NAT GAS) Highlights Existing Gas: -20,000 MMBtu/day...

AI summary The document discusses assumptions related to natural gas in the 2020 Integrated Resource Plan (IRP) of Nova Scotia Power. It outlines existing, peaking, and baseload gas assumptions, including pipeline capacity, pricing, and supply commitments.

80 NATURAL GAS – EXISTING GAS Nova Scotia Power IRP Final Report Appendix H Page 100 of 321

AI summary The text references the 'Natural Gas – Existing Gas' section from the Nova Scotia Power Integrated Resource Plan (IRP) Final Report, Appendix H, page 100 of 321.

Platts Analytics TCPL Empress to E. Hereford High Case (June 2019) and PNGTS to Westbrook modelled as fixed costs 2020 IRP ASSUMPTIONS SET 81 NATURAL GAS – PEAKING GAS Nova Scotia Power IRP Final Report Appendix H Page 101 of 321 (LNG WINT...

AI summary The document outlines assumptions for natural gas pricing in Nova Scotia Power's 2020 Integrated Resource Plan (IRP), including winter and summer base prices, transportation costs, and regasification costs. It references data from Global Platts Analytics and specific locations such as Baileyville and Tufts Cove.

e 2019) Source: Current or (4Q2019) Reference, Low or High Case negotiated Tolls Reference, Low or High Case 2020 IRP ASSUMPTIONS SET 82 Nova Scotia Power IRP Final Report Appendix H Page 102 of 321 NATURAL GAS – BASELOAD Delivered = Commo...

AI summary The document outlines the assumptions for natural gas delivered prices in the 2020 Integrated Resource Plan (IRP), breaking down costs into commodity, basis, transportation, and market premium components. The base and low case scenarios are modeled using data from Global Platts Analytics and include fixed and variable cost components.

nalytics (4Q2019) Platts Analytics Cove modelled as variable Low Case (June 2019) costs High = Henry Hub + AECO + Tolls Nova to Tufts Cove + Nil modelled as fixed costs Source: Global Platts Source: Global Fuel & Usage Nova to Tufts Analyt...

AI summary The document discusses alternative natural gas supply arrangements for Nova Scotia Power's Integrated Resource Plan (IRP), noting that not all options can be modeled due to complexity. Options like dual fuel capability, natural gas storage, and LNG alternatives are mentioned but not included in the current IRP model.

he amount of turns and resultant withdrawal rates, etc.) • As per the Dual Fuel Capability option, NS Power will study this option in detail if new gas units are part of the IRP recommendation 2020 IRP ASSUMPTIONS SET 89 Nova Scotia Power...

AI summary The document discusses LNG alternatives as virtual pipelines and outlines assumptions for sustaining capital costs for coal units in the 2020 Integrated Resource Plan (IRP), including high and low sensitivity scenarios for sustaining capital costs.

mpare economics. • NSP proposes that the High and Low sustaining capital cost sensitivities will assume the following: • High = Base + 50% • Low = Base – 25% 2020 IRP ASSUMPTIONS SET 92 SUSTAINING CAPITAL FORECAST – Nova Scotia Power IRP F...

AI summary Nova Scotia Power (NSP) is proposing sensitivity assumptions for sustaining capital costs, with High set at Base + 50% and Low at Base – 25%. The text includes a visual representation of sustaining capital forecasts for coal and CTs (combustion turbines) over several years.

$6,000 $4,000 $2,000 $0 2021 2022 2023 2024 2025 2026 2027 2028 2029 2030 2031 2032 2033 2034 2035 2036 2037 2038 2039 2040 2041 2042 2043 2044 2045 Burnside 1 Burnside 2 Burnside 3 Burnside 4 Tusket VJ 1 VJ 2 TUC 4 TUC 5 2020 IRP ASSUMPTI...

AI summary The 2020 Integrated Resource Plan (IRP) outlines a significant transformation in the electric utility sector over the next 25 years, focusing on the transition to a decarbonized system. It highlights the shift from traditional synchronous generators to inverter-based non-synchronous generation and tests the implications of retiring major large synchronous generators.

for a very long time. • This IRP will test the retirement of major large synchronous generators with replacement by inverter-based non-synchronous generation (or other lower emitting generators). • The retirement of coal fired generators w...

AI summary This section discusses the 2020 Integrated Resource Plan (IRP) assumptions, focusing on the retirement of coal-fired generators and the challenges of replacing them with inverter-based generation. It highlights the need for grid services such as ramping reserve, system strength, and volt-ampere-reactive support to maintain system stability.

ion to maintain stable and secure operation of the system.  Ramping reserve and net load following capabilities  System strength and short circuit ratio  Volt-Ampere-Reactive support  Kinetic energy and synchronous inertia requirement...

AI summary The document discusses essential grid services such as ramping reserve, system strength, and volt-ampere-reactive support, emphasizing their role in ensuring stable and secure system operation. These services are represented as dynamic constraints in the model to integrate renewable resources. The text also references a letter from the Alternative Resource Energy Authority (AREA) commenting on Nova Scotia Power's IRP assumptions.

ions, (ii) restate some items we feel remain unaddressed and (iii) to provide our perspective on IRP work that NSPI has alluded to using to alter rates utilized by our organization and our affiliates. Thank you for confirming that NSPI und...

AI summary The text discusses concerns raised by AREA regarding the Integrated Resource Plan (IRP) and the cost assumptions for renewable energy projects. AREA argues that NSPI's reports may mislead readers about the likelihood of lower renewable energy costs and that the process does not consider alternative financing options that could accelerate decarbonization.

raints. AREA requests that NSPI consider modelling additional decarbonization efforts in each scenario and at what price other sectors would need to pay NSPI to affect such additional decarbonization. Alternative Resource Energy Authority,...

AI summary The Alternative Resource Energy Authority (AREA) requests that Nova Scotia Power (NSPI) consider additional decarbonization efforts in each scenario and the cost implications for other sectors. The document references the Integrated Resource Plan (IRP) and discusses ELCC assumptions based on studies by E3, including the impact of wind energy on the planning reserve margin.

NSPI system is measured by the marginal ELCC and is currently at 11%, meaning that each additional MW of wind contributes 0.11 MW of firm capacity to PRM requirements. In its recent 2020 Annually Adjusted Rates Application filed with the N...

AI summary The NSPI system's marginal ELCC is currently at 11%, indicating that each additional MW of wind contributes 0.11 MW of firm capacity to PRM requirements. NS Power proposed using a 32% capacity contribution factor for wind generation in 2020, based on past approvals, but has since revised its methodology to a 17% factor for existing wind resources. A pre-IRP study on ELCC calculations will influence future capacity contribution factors for billing purposes.

IRP process is completed, NS Power will revisit justification for the continued applicability of the 32 percent capacity contribution factor for BUTU billing purposes.” We wish to specifically note that the 2020 IRP process is not the appr...

AI summary The document discusses the inappropriateness of using the Integrated Resource Plan (IRP) process to determine the capacity contribution factor for the Back-Up/Top-Up (BUTU) Tariff. It emphasizes that the IRP is a generic planning tool and not a rate design process. The BUTU Tariff is tied to specific non-Nova Scotia Power generation facilities and should be addressed separately.

IRP process nor do we see the IRP process as the appropriate venue for consideration of such issues. Thank you for considering our input. Regards, Aaron Long Director of Business Services Cc: Lia MacDonald, Senior Director Enterprise Asset...

AI summary The document includes a submission by the Canadian Wind Energy Association and the Canadian Solar Industries Association regarding the assumptions and draft analysis plan of Nova Scotia Power's 2020 Integrated Resource Plan. The submission is part of a regulatory proceeding and is addressed to various stakeholders including Nova Scotia Power and the Alternative Resource Energy Authority.

and energy storage. The new organization will officially launch on July 1, 2020. In the meantime, CanSIA and CanWEA will work hand-in-hand to represent wind, solar and energy storage in Nova Scotia. Comments The Canadian Wind Energy Associ...

AI summary CanWEA and CanSIA provide comments on Nova Scotia Power’s 2020 Integrated Resource Plan, expressing general support for the evaluation criteria but raising concerns about the attention given to risk assessment, particularly in economic and price-related aspects.

ess, economic and price 1 Nova Scotia Power IRP Final Report Appendix H Page 123 of 321 considerations are reinforced by the consideration of two metrics (i.e., revenue requirements and rates) as are reliability considerations (reliability...

AI summary The document discusses the importance of using realistic assumptions in wind integration strategies within Nova Scotia Power's Integrated Resource Plan (IRP), emphasizing best practices and the least-cost resource, onshore wind, as indicated by the E3 analysis.

gulation signals will help off-set any generation/load imbalance in the NS Power system. Such imbalances could be from rapid changes in wind and solar generation or any generation surplus or shortage. The IRP presents a series of assumptio...

AI summary The document discusses the importance of regulation signals in balancing generation and load in the NS Power system, particularly with renewable sources. It highlights the Integrated Resource Plan (IRP) assumptions on technology costs and their impact on Levelized Cost of Energy (LCOE) and revenue requirement profiles. CanWEA suggests using price benchmarks to assess the reasonableness of these assumptions and recommends more explicit LCOE values for transparency.

more explicit identification of these LCOE values would facilitate such direct comparisons and enhance the transparency of the IRP and ideally confirmation of the reasonableness of these assumptions. A wide range of natural gas-fired gener...

AI summary The document discusses the importance of explicitly identifying Levelized Cost of Energy (LCOE) values in the Integrated Resource Plan (IRP) to enhance transparency and confidence in the reasonableness of assumptions. It also highlights concerns about natural gas supply constraints in Nova Scotia due to pipeline limitations and the potential impact of new LNG projects in the US.

on criteria. Also, we have no additional comments on the Draft Analysis Plan since the comments we sent you on February 5. We appreciated the webinar on February 7, which clarified a number of points. 1. Load Assumptions We appreciated Mr....

AI summary The text discusses load assumptions and new supply-side options in the context of an integrated resource plan. It raises concerns about EV load shapes, uncertainty in load forecasting, and the differences in costs between utility-built resources and independent power producer contracts.

urce and a contract with an independent power producer to build and operate a generating unit. Ideally, once the IRP is completed, any recommendations for procurement would be tested in an all-source Resource Insight, Inc. • 5 Water Street...

AI summary The text references the Integrated Resource Plan (IRP) and a contract with an independent power producer to build and operate a generating unit. It mentions that once the IRP is completed, procurement recommendations will be tested in an all-source context.

Nova Scotia Power IRP Final Report Appendix H Page 126 of 321 Input on Draft Assumptions Set Page 2 of 10 procurement that allows self-build options to compete with private developer offerings. We were somewhat surprised to learn that deco...

AI summary The text discusses the importance of including decommissioning costs in the Integrated Resource Plan (IRP) model, even though they may be small relative to other costs. It also highlights the need to consider flexible solar and hybrid (renewable + storage) resources as supply-side capacity options, noting their potential to provide inexpensive reserves and their absence from the current Assumptions Set.

Nova Scotia Power IRP Final Report Appendix H Page 127 of 321 Input on Draft Assumptions Set Page 3 of 10 capacity expansion model may affect the selection of the optimal capacity resources. Regarding the supply-side cost assumptions, we w...

AI summary The text discusses concerns about the assumptions used in Nova Scotia Power's Integrated Resource Plan (IRP) regarding supply-side costs for renewable and storage projects. It highlights a comparison between NS Power's assumptions and those from Lazard, noting discrepancies in cost estimates.

and other customer values), or • if NS Power cannot estimate the non-energy benefits, just the costs paid by NS Power, reduced by T&D benefits (reduced line losses, avoided investments). 4. Planning Reserve Margin and Capacity Value Study...

AI summary The document discusses the Planning Reserve Margin and Capacity Value Study, focusing on the DAFOR (Demand Availability Factor) for various generation units. It highlights discrepancies between historical DAFOR averages and assumptions used in the E3 study, suggesting the need for a longer averaging period. It also addresses the effective load-carrying capacity (ELCC) of thermal and wind generation units and the derating of thermal plants for capacity planning.

tical results. The thermal plant contribution to reliability contributions appear to fall into a few buckets, based on the size and DAFOR data in Table 9: • Large, low-DAFOR (TC 3, Lingan 1, PT 2) John D. Wilson and Paul Chernick • Resourc...

AI summary The text discusses the thermal plant contribution to reliability based on size and DAFOR data from Table 9, listing specific thermal plants such as TC 3, Lingan 1, and PT 2. It also references the Nova Scotia Power IRP Final Report and mentions individuals involved in the analysis.

Nova Scotia Power IRP Final Report Appendix H Page 131 of 321 Input on Draft Assumptions Set Page 7 of 10

AI summary The text refers to the Nova Scotia Power Integrated Resource Plan (IRP) Final Report, specifically Appendix H, which includes input on draft assumptions set, and is on page 7 of 10.

Nova Scotia Power IRP Final Report Appendix H Page 132 of 321 Input on Draft Assumptions Set Page 8 of 10 Also, please make visible the numerical values behind Figure 27. (E3 Capacity Value Study, p. 55) We also recommend that NS Power con...

AI summary The text discusses concerns regarding the Integrated Resource Plan (IRP) assumptions, particularly the need to consider feeder circuit outages on DAFOR and the impact of energy efficiency (EE) on ELCC values. It highlights the importance of modeling EE programs individually and the potential for forecasted ELCC values to miss diversity benefits from a mix of resources.

ng diversity benefits associated with a mix of resources. This could result in the analysis selecting too much of the resources with high ELCC values in the E3 study and too little of other resources. 5. Planning Reserve Margin and Capacit...

AI summary The text discusses concerns with the E3 study's methodology in selecting resources based on ELCC values and raises questions about the relationship between weather data and load profiles in the Capacity Value Study. It also references a response by NS Power to the NSUARB regarding the 2020 ACE Plan, highlighting poor performance of specific hydro feeders.

would either understate the emissions from New Brunswick coal or New England gas (and hence the cost of meeting emission limits), or ignore economic imports of fossil generation. 7. Fuel Pricing - Natural Gas We previously asked about an a...

AI summary The text discusses fuel pricing for natural gas, addressing concerns about potential firming costs due to unreliable pipeline supply. It clarifies that alternative gas supply options would be evaluated after the Integrated Resource Plan (IRP) and that option 3 is considered feasible and sufficient for gas units in the IRP.

Nova Scotia Power IRP Final Report Appendix H Page 134 of 321 Input on Draft Assumptions Set Page 10 of 10 8. Sustaining Capital for Existing Units We have several questions about this forecast. • Please confirm or correct our understandin...

AI summary The text raises questions about the assumptions used in the Integrated Resource Plan (IRP) regarding the utilization factors for existing units and how they affect sustaining capital forecasts. It asks whether the IRP uses historical data to define high utilization, if the ACE plan uses different factors, and whether capital costs are adjusted for plant age.

t. • Does projected sustaining capital for each unit simply reflect historical experience plus inflation, or is the projected capital cost increased to reflect the age of the plant? 9. Renewable Integration The renewable integration sectio...

AI summary The text raises questions about the methodology used in projecting sustaining capital costs for power units, specifically whether inflation and plant age are considered. It also critiques the renewable integration section of the Integrated Resource Plan (IRP) for lacking clarity on technology options and grid service requirements, suggesting a webinar to explain and gather stakeholder feedback.

On behalf of the Consumer Advocate, Resource Insight would like to submit some additional comments on the draft analysis plan. Previously, we suggested including resiliency testing related to a major natural disaster. We have reflected on...

AI summary The Consumer Advocate, through Resource Insight, suggests adding a section to the Integrated Resource Plan (IRP) to assess the impact of extreme natural disasters on Nova Scotia’s energy infrastructure, considering scenarios like sea level rise and category 5 hurricanes, and evaluating potential damage to thermal, hydro, solar, and wind facilities, as well as transmission and distribution systems.

Would restoration be affected by damage to other energy supplies or key infrastructure? • Would adequate generation be available to serve load as the T&D system is restored? Resource Insight, Inc. • 5 Water Street • Arlington, Massachusett...

AI summary The document raises questions about the resilience of energy restoration in the context of Nova Scotia Power's Integrated Resource Plan (IRP), including whether certain strategies, investments, or technologies like BTM solar and storage could enhance system resilience.

t: Input on Draft Scenarios, Strategies and Sensitivities On behalf of the Consumer Advocate, Resource Insight would like to submit some comments on the draft scenarios, strategies and sensitivities. Scenarios As we understand the plan, NS...

AI summary Resource Insight, on behalf of the Consumer Advocate, submits comments on NS Power's draft scenarios, suggesting an alternative to Scenario 2 that includes an early coal phase-out and higher industrial/marine demand to better differentiate scenarios and expand the decision space.

ricity, for 3D printing, automation and the like. The improvements in batteries and electric propulsion that promote electric road vehicles will also support electrification of marine vessels and such Resource Insight, Inc. • 5 Water Stree...

AI summary The document discusses the impact of industrial and marine electrification on load modeling within the Integrated Resource Plan (IRP), and highlights that Nova Scotia Power (NSP) has not tested early coal closure with the 'current landscape' strategy. An alternative scenario is suggested to address this gap.

native scenario suggestion, above, would address that gap. If NSP does not want to add a scenario to consider this option, some scenario/strategy pairing(s) should be modified to get at this question. Strategies The strategies seem to cove...

AI summary The document discusses the need for additional scenarios and strategy pairings in the Integrated Resource Plan (IRP) to evaluate the 'no new emitting resources' strategy as a portfolio sensitivity. It also questions the current approach of testing only one strategy under the comparator case and suggests including multiple strategies for comparison. Sensitivities, such as the price of exported power, are also raised for consideration.

ding the price paid for power exported from Nova Scotia? Is that price modeled to follow import price? Is 1 Also, the term “comparator case” isn’t as clear as the rest of the scenario descriptions. John D. Wilson and Paul Chernick • Resour...

AI summary The text discusses the modeling of export prices from Nova Scotia and questions whether they follow import prices. It also raises concerns about the clarity of the 'comparator case' and suggests testing the impact of different policy scenarios, such as net zero carbon and comparator case policies, on each other.

February 5, 2020 Nova Scotia Power IRP Final Report Appendix H Page 140 of 321 February 14, 2020 RE: 2020 IRP Assumptions IPCC goals outline significant greenhouse gas targets for the globe. Given the context of rapid climatic change the f...

AI summary The submission highlights the need for the Integrated Resource Plan (IRP) to consider more aggressive carbon reduction scenarios, including net zero, and to incorporate grid resiliency and sharing of hydro resources in response to rapid climate change and regulatory goals.

ies. Not only would this investment allow these facilities to hedge against rising fuel costs in the future, but the overall reduction of GHG would be a significant benefit to the province as a whole. The consultants findings are summarize...

AI summary The submission highlights the benefits of investing in facilities to hedge against rising fuel costs and reduce GHG emissions. However, consultants identified risks related to distribution interconnection and the age of the grid, which may hinder the implementation of renewable energy projects, including a CHP plant.

rresponding author. Tel.: +1 (902) 403 8583. use of renewable electricity generation for powering those EVs. E-mail address: [email protected] (N.S. Pearre). http://dx.doi.org/10.1016/j.enconman.2015.11.066 0196-8904/Ó 2015 Elsevier Ltd....

AI summary The text includes an author's contact information and a reference to a study on the use of renewable electricity for electric vehicles. It also mentions an appendix from Nova Scotia Power's Integrated Resource Plan (IRP) Final Report and a nomenclature section with terms related to electric vehicles and time-of-day (TOD) electric rates.

W to 22 MW. These modification occur pre- cisely when required, as this is an idealized implementation. for which detailed generation output and transmission system data To more broadly quantify the effects of charging algorithm, each were...

AI summary The text discusses the modification of charging algorithms and their effects on generation output and transmission system data, referencing an analysis conducted during the first half of 2014. It also mentions the sorting of export power curves and references a submission by Digby and a report by Nova Scotia Power's IRP.

Fraction (%) tracted from the greater grid supply will require additional generation elsewhere [21]. Thus the greater question is whether

AI summary The text discusses the impact of energy generation and consumption on the grid, noting that energy drawn from the grid may necessitate additional generation elsewhere, raising questions about system efficiency and planning.

California: constructing consumer-informed recharge profiles. Transport Res Acknowledgements Part D: Transport Environ 2010;15(6):212–9. [19] Pearre LSN. High-resolution residential electricity consumption trends under We thank Terry Thibo...

AI summary The text acknowledges contributions from individuals and organizations involved in transportation surveys and electricity data collection, referencing Nova Scotia Power's Integrated Resource Plan (IRP) and related appendices. It also mentions funding from the Nova Scotia government.

ova Scotia Power IRP Final Report Appendix H Page 157 of 321 EcoStruxure Microgrid Advisor Connect, monitor, and control your facility’s Distributed Energy Resources (DER) to optimize performance

AI summary The text mentions EcoStruxure Microgrid Advisor, a tool for connecting, monitoring, and controlling Distributed Energy Resources (DER) to optimize performance. It is part of Nova Scotia Power's Integrated Resource Plan (IRP) Final Report Appendix H.

ility’s efficiency, resiliency, and sustainability, visit www.schneider-electric.us/microgrid Schneider Electric 800 Federal Street Andover, MA 01810 www.schneider-electric.us/microgrid October 2017 ©2017 Schneider Electric. All Rights Res...

AI summary The text includes a submission from the Municipality of the District of Digby regarding storage systems, submitted in November 2018. It references the Nova Scotia Power IRP Final Report Appendix H, and mentions Sigma Energy Storage Inc. as a party involved.

for the Municipality of the District of Digby Sigma Energy Storage Inc. November 2018 - CONFIDENTIAL page 3 infrastructure and capacity building projects. As a part of these funding agreements, Nova Scotia municipalities are required to de...

AI summary The document discusses the development of Integrated Community Sustainability Plans (ICSPs) by Nova Scotia municipalities under the Gas Tax Agreement (GTA), emphasizing sustainability principles. The Municipality of the District of Digby has included goals such as maximizing renewable energy opportunities, reducing the carbon footprint, and managing energy for a marketable industrial park in its strategic plan.

in Digby. An Eco Industrial Park (EIP) is a community of manufacturing and service businesses seeking enhanced environmental and economic performance through collaborating in the management of environmental and resource issues [10]. Follow...

AI summary The text discusses the potential development of an Eco Industrial Park (EIP) in Digby, emphasizing strategies such as energy and material pooling, reducing consumption, and managing waste to improve environmental and economic performance. The municipality's economy has historically relied on fishing, forestry, agriculture, and fur farming, with a focus on industrial growth near Highway 217.

r the Municipality of the District of Digby Sigma Energy Storage Inc. November 2018 - CONFIDENTIAL page 33 6 Conclusions Energy storage is a valuable tool for reducing electric bills, making facilities resilient, and earning revenue, espec...

AI summary The document discusses the benefits of energy storage and renewable resources in the Municipality of the District of Digby, Nova Scotia, including economic and environmental advantages. It outlines four systems under consideration, such as PV-Thermal Energy Storage and biomass systems, and references a table summarizing their technical and financial analyses.

Flexible Sheddable Critical Basic Loads Confidential Property of Schneider Electric Page 13 Digby Submissions February 14, 2020 Page 62 of 62 Nova Scotia Power IRP Final Report Appendix H Page 203 of 321 tel. 902.429.2202 2705 Fern Lane, f...

AI summary The Ecology Action Centre (EAC) submitted comments on the 2020 Integrated Resource Plan (IRP) assumptions and analysis plan, participating as a stakeholder in the process. The submission responds to the draft assumptions set and analysis plan, including updates released in January and February 2020.

onse to the below documents: i) 2020 IRP Draft Assumptions Set (Jan 20, 2020) ii) 2020 IRP Draft Assumptions Addendum/Update (Feb 3, 2020) iii) 2020 IRP Draft Analysis Plan It is also important to note in this submission that the capacity...

AI summary The submission highlights concerns about the limited capacity of the Ecology Action Centre (EAC) and other organizations to engage effectively in the 2020 Integrated Resource Plan (IRP) process due to a lack of financial and structural support. The EAC emphasizes the need for updated mandates from the Department of Energy and Mines or Nova Scotia Power to address climate change and environmental concerns effectively.

r power in Nova Scotia, with the addition of about 480 MW  Building a second transmission link to New Brunswick, and importing about 200MW of existing hydroelectricity capacity from Quebec. Although this report is not primarily an economi...

AI summary The report outlines a low-carbon pathway for Nova Scotia Power, including measures such as adding 480 MW of renewable power, building a transmission link to New Brunswick, and importing 200 MW of hydroelectricity from Quebec. It estimates a net annual cost of $200 million, which is about half of one percent of Nova Scotia's economic output. The measures are expected to reduce greenhouse gas emissions by over 69% below 2005 levels by 2030.

The lack of ambition in the proposed long-term emissions pathway proposed in the 2030-2040 pathway is the EAC’s main point for criticism of this equivalency agreement renewal process. Therefore, the EAC believes that the forecast CO2 emiss...

AI summary The EAC criticizes the lack of ambition in the proposed long-term emissions pathway for the 2030-2040 period, arguing that the forecast CO2 emissions hard caps in the 2020 IRP Draft Assumptions Set should be the least ambitious scenario modeled, with all other scenarios requiring greater emissions reductions. The EAC also highlights that the proposed pathway aligns with the business-as-usual case of continuing coal use until at least 2042, which it deems unacceptable.

osed by Nova Scotia, or the 2030-2040 period should be removed from this analysis entirely until such a time that clarity on future equivalency for the post-2030 period can be reached. c. Complete Coal Phase-Out Scenario Given the uncertai...

AI summary The EAC recommends removing the 2030-2040 period from analysis due to uncertainty regarding future equivalency agreements and supports a coal phase-out scenario by 2029. The EAC emphasizes the need for a just and affordable transition for affected communities and workers.

tel. 902.429.2202 2705 Fern Lane, fax. 902.405.3716 Halifax, NS, B3K 4L3 i Synapse Energy Economics, Inc. for Nova Scotia Utility and Review Board: Nova Scotia Power Inc. Thermal Generation and Utilization and Optimization - M08059 May 1,...

AI summary The text includes references to regulatory proceedings involving Nova Scotia Power Inc. and the Nova Scotia Utility and Review Board, including a final report appendix and comments on the 2020 Integrated Resource Plan (IRP). It also references a memo from the Ecology Action Centre and a quantitative analysis of carbon dioxide emissions from coal-fired generation.

Nova Scotia Power IRP Final Report Appendix H Page 211 of 321 EfficiencyOne Comments M08929 - NS Power 2020 IRP - Draft Assumptions and Analysis Plan

AI summary The document references EfficiencyOne's comments on the Nova Scotia Power 2020 Integrated Resource Plan (IRP) Draft Assumptions and Analysis Plan, identified by the matter number M08929.

1 Introduction 2 EfficiencyOne appreciates the opportunity to provide comments on NS Power’s 2020 Integrated 3 Resource Plan (IRP) draft Analysis Plan and Assumptions Set. 4 5 EfficiencyOne submits the following comments, questions and rec...

AI summary EfficiencyOne provides comments on NS Power’s 2020 Integrated Resource Plan (IRP) draft Analysis Plan and Assumptions Set, emphasizing the need for clear evaluation criteria and scoring methods. They recommend that NS Power define how each metric will be quantified and provide detailed rationale for the ranking of resource plans.

resource plans. 26 • NS Power provides alongside the ranking of all CRPs the rationale for the ranking, 27 detailing how the scores of the evaluation criteria were considered. 28 29 Date: February 14, 2020 Page 1 of 15 Nova Scotia Power IR...

AI summary The text discusses Nova Scotia Power's Integrated Resource Plan (IRP) and the rationale provided for ranking Candidate Resource Plans (CRPs), including how evaluation criteria scores were considered in the process.

Nova Scotia Power IRP Final Report Appendix H Page 212 of 321 EfficiencyOne Comments M08929 - NS Power 2020 IRP - Draft Assumptions and Analysis Plan

AI summary This document references EfficiencyOne's comments on the Nova Scotia Power 2020 Integrated Resource Plan (IRP) draft assumptions and analysis plan, as part of the proceeding identified by matter number M08929.

1 EfficiencyOne’s comments on specific evaluation criteria as proposed by NS Power are as follows: 2 I. Minimization of NPV of the annual revenue requirements over 25 years (slide four, row 3 one) 4 EfficiencyOne agrees that this is an app...

AI summary EfficiencyOne provides feedback on NS Power's proposed evaluation criteria for the Integrated Resource Plan (IRP), agreeing with the minimization of NPV of annual revenue requirements over 25 years but questioning the use of a 10-year NPV metric for assessing rate effects. EfficiencyOne also recommends eliminating CRPs that do not meet reliability requirements and requests clarification on the metrics used for reliability screening.

idered for this evaluation criteria are listed 24 on slide 4, row three of the Draft Analysis Plan document. If not, please list all metrics that 25 will be considered. 26 Date: February 14, 2020 Page 2 of 15 Nova Scotia Power IRP Final Re...

AI summary The text refers to the EfficiencyOne Comments and a draft analysis plan document, specifically slide 4, row three, and mentions metrics to be considered for an evaluation criteria. It also references the Nova Scotia Power IRP Final Report and a matter number (M08929).

Nova Scotia Power IRP Final Report Appendix H Page 213 of 321 EfficiencyOne Comments M08929 - NS Power 2020 IRP - Draft Assumptions and Analysis Plan

AI summary The text references EfficiencyOne's comments on the NS Power 2020 Integrated Resource Plan (IRP) Draft Assumptions and Analysis Plan, identified by matter number M08929.

1 IV. Provision of essential grid services for system stability and reliability (slide four, row four) 2 E1 recommends the following: 3 • all CRPs that do not meet requirements for essential grid services be eliminated at the 4 reliability...

AI summary E1 recommends eliminating CRPs that fail to meet essential grid service requirements during reliability screenings and incorporating integration costs into the IRP NPV. EfficiencyOne questions how robustness is measured and suggests combining it with the 25-year NPV metric. They also recommend quantifying total emissions per CRP and clearly defining metrics for other emissions types.

types of emissions are to be considered as criteria such as mercury, SOx, NOx, 26 these emission types to be listed, and metrics assigned. 27 28 VII. Flexibility 29 It is unclear how a “qualitative assessment of timing of investments” will...

AI summary EfficiencyOne raises concerns about the evaluation criterion of a qualitative assessment of investment timing in the Integrated Resource Plan (IRP), noting the risk of delaying major decisions to 2025. The comment highlights the need for clarity on how this flexibility will be applied.

Nova Scotia Power IRP Final Report Appendix H Page 214 of 321 EfficiencyOne Comments M08929 - NS Power 2020 IRP - Draft Assumptions and Analysis Plan

AI summary The document references EfficiencyOne's comments on the Nova Scotia Power 2020 Integrated Resource Plan (IRP) Draft Assumptions and Analysis Plan, identified by matter number M08929.

1 years out, and delay benefits of grid modernization and GHG emission reductions that cannot be 2 captured in a revenue requirement. 3 4 DSM is a flexible resource in terms of the ability to adjust activity levels in response to changes 5...

AI summary EfficiencyOne requests NS Power to clarify metrics and processes related to DSM flexibility and the Analysis Plan, including how CRPs are assessed, the relationship between planning documents, and how environmental regulation changes would impact the IRP and CRPs.

it be determined if this change is a “decision gate”? If it is determined to be a “decision 27 gate” would this lead to a reassessment of CRPs and a change in the Preferred Resource 28 Plan? 29 30 3. Environmental Date: February 14, 2020 P...

AI summary The text raises a question about whether a change is a 'decision gate' and whether this would lead to a reassessment of Candidate Resource Plans (CRPs) and a change in the Preferred Resource Plan. The mention of 'Environmental' suggests environmental considerations may be involved.

Nova Scotia Power IRP Final Report Appendix H Page 215 of 321 EfficiencyOne Comments M08929 - NS Power 2020 IRP - Draft Assumptions and Analysis Plan

AI summary The text references EfficiencyOne's comments on the NS Power 2020 Integrated Resource Plan (IRP) Final Report, specifically Appendix H, page 215 of 321, and relates to matter number M08929.

1 EfficiencyOne requests clarification on the following questions regarding NS Power’s 2 environmental assumptions: 3 • Does NS Power expect to sell excess GHG credits resulting from lower emissions? If yes, 4 how will the cost of carbon (...

AI summary EfficiencyOne seeks clarification from NS Power on environmental assumptions, including the handling of GHG credits, CO2 emission caps, and the calculation of DSM avoided costs in the Integrated Resource Plan (IRP). The discussion focuses on how environmental compliance costs and revenue from carbon credits are incorporated into the modeling process.

rrect or undecided, EfficiencyOne requests that 24 NS Power provide clarification before the IRP modelling process proceeds. 25 26 Importance of the Preferred Resource Plan 27 It is critical that an output of the IRP is a Preferred Resourc...

AI summary EfficiencyOne requests NS Power to clarify the IRP modelling process before proceeding. It emphasizes the importance of producing a Preferred Resource Plan as an output of the IRP, which should be the highest ranked CRP based on evaluation criteria.

Nova Scotia Power IRP Final Report Appendix H Page 216 of 321 EfficiencyOne Comments M08929 - NS Power 2020 IRP - Draft Assumptions and Analysis Plan

AI summary The document references EfficiencyOne's comments on the Nova Scotia Power 2020 Integrated Resource Plan (IRP) Draft Assumptions and Analysis Plan, identified by matter number M08929.

1 “The value in conducting a long term IRP exercise is its ability to consider the potential 2 impact of all decisions both to add capital and to add DSM over the longer term. The 3 reference to test that in future decisions is the Preferr...

AI summary The text discusses the importance of selecting a Preferred Resource Plan (PRP) in the Integrated Resource Plan (IRP) process to accurately calculate avoided costs of Demand Side Management (DSM). Using a business-as-usual plan as a reference leads to underestimation of DSM benefits and flawed outcomes in evaluations.

cing a flawed outcome. 22 23 EfficiencyOne strongly recommends the following: 24 • A single Preferred Resource Plan is an outcome of the 2020 IRP. 25 26 EfficiencyOne requests the following: 27 • NS Power to clarify whether or not there wi...

AI summary EfficiencyOne highlights concerns regarding the 2020 Integrated Resource Plan (IRP) and requests clarification on whether a single Preferred Resource Plan will be identified. It also inquires about the methodology for calculating demand-side management (DSM) avoided costs if no single CRP is chosen.

Nova Scotia Power IRP Final Report Appendix H Page 217 of 321 EfficiencyOne Comments M08929 - NS Power 2020 IRP - Draft Assumptions and Analysis Plan

AI summary This document references EfficiencyOne's comments on the Nova Scotia Power 2020 Integrated Resource Plan (IRP) draft assumptions and analysis plan, identified under matter number M08929.

1 Difference-in-Revenue-Requirements Method 2 Avoided energy and avoided capacity costs were calculated through a DIRR method in the 2014 3 IRP and is the standard industry practice.2 Two CRPs are necessary for the calculation using this 4...

AI summary The document discusses the Difference-in-Revenue-Requirements (DIRR) method for calculating avoided energy and capacity costs in the context of the Integrated Resource Plan (IRP). It outlines the need for two Candidate Resource Plans (CRPs) — one with DSM and one without — and highlights the importance of selecting the highest-ranked CRP without DSM for accurate cost estimation. Transmission and distribution costs are not modeled in the IRP, but historical avoided costs have been shared by NS Power.

Nova Scotia Power IRP Final Report Appendix H Page 218 of 321 EfficiencyOne Comments M08929 - NS Power 2020 IRP - Draft Assumptions and Analysis Plan

AI summary The document references EfficiencyOne's comments on the Nova Scotia Power 2020 Integrated Resource Plan (IRP) Draft Assumptions and Analysis Plan, identified by the matter number M08929.

1 As of February 2019, NS Power has been aware of an error in the avoided T&D calculations it had 2 been providing to EfficiencyOne and the DSMAG since 2016, which appears to result in the 3 avoided costs being understated by a factor of 3...

AI summary NS Power has been aware of a significant error in avoided T&D cost calculations provided to EfficiencyOne and the DSMAG since 2016, which may have understated costs by a factor of 30 to 100. EfficiencyOne highlights the potential impact on the 2020 IRP process if this issue is not addressed, as it could lead to sub-optimal DSM selections.

ial may be underestimated in a 22 material manner. This would translate to the four Potential Study scenarios used as an 23 input to the 2020 IRP potentially being higher, with the result that more DSM be included 24 in the Preferred Resou...

AI summary The text discusses potential underestimation of costs in the 2020 Integrated Resource Planning (IRP) process, which could result in higher demand-side management (DSM) inclusion in the Preferred Resource Plan and increased investment targets for future DSM Plans. This is based on discussions with NS Power and references to prior filings and analyses.

Nova Scotia Power IRP Final Report Appendix H Page 219 of 321 EfficiencyOne Comments M08929 - NS Power 2020 IRP - Draft Assumptions and Analysis Plan

AI summary The document refers to EfficiencyOne's comments on Nova Scotia Power's 2020 Integrated Resource Planning (IRP) Final Report, specifically Appendix H, Page 219 of 321, and relates to matter number M08929.

1 T&D costs identified by Paul Chernick exists. As stated in EfficiencyOne’s 2019 RBIA: 2 “If they cannot be produced through the upcoming 2020 IRP it is recommended that NS 3 Power update and correct the values produced outside of the IRP...

AI summary EfficiencyOne highlights errors in NS Power's T&D avoided cost calculations and recommends corrections before use in the 2020 IRP. It also suggests adjusting DSM Potential Study scenarios by aligning with the 2020-2022 Supply Agreement rather than shifting years forward.

Nova Scotia Power IRP Final Report Appendix H Page 220 of 321 EfficiencyOne Comments M08929 - NS Power 2020 IRP - Draft Assumptions and Analysis Plan

AI summary This document references EfficiencyOne's comments on Nova Scotia Power's 2020 Integrated Resource Planning (IRP) Final Report, specifically Appendix H, Page 220 of 321, and is related to Matter M08929 concerning the Draft Assumptions and Analysis Plan.

ve franchise for certain DSM activities in Nova Scotia, other 28 agency direct involvement in electricity DSM is considered immaterial in Nova Scotia, outside of 29 the regulated environment. 30 Date: February 14, 2020 Page 10 of 15 Nova S...

AI summary The text discusses the limited role of agencies in electricity demand-side management (DSM) in Nova Scotia, indicating that their involvement is considered immaterial outside the regulated environment. It also references a comment from EfficiencyOne and a draft assumptions and analysis plan related to the 2020 Integrated Resource Planning (IRP) report by Nova Scotia Power.

Nova Scotia Power IRP Final Report Appendix H Page 221 of 321 EfficiencyOne Comments M08929 - NS Power 2020 IRP - Draft Assumptions and Analysis Plan

AI summary This document references EfficiencyOne's comments on Nova Scotia Power's 2020 Integrated Resource Planning (IRP) Final Report, specifically Appendix H, page 221 of 321, and relates to the matter number M08929.

1 As described above consumer behaviour and investments, energy efficiency codes and standards, 2 initiatives undertaken by other agencies, and technological and market developments are part of 3 NS Power’s Before DSM load forecast, which...

AI summary EfficiencyOne questions NS Power's use of the 2019 'Before DSM' Load Forecast for the IRP, noting that it may not fully exclude DSM and may include forward-looking DSM data from the US Northeast. EfficiencyOne recommends replacing the 2021 and 2022 years of the Potential Study scenarios with those from the 2020-2022 Supply Agreement.

28 NS Power Load Forecast, a geographic area with high levels of DSM activity. Precedent exists for 29 the process of removing future DSM influences (from USEIA data) from the load forecast of a 7 M09191, N-1, 2019 Load Forecast, Filed Apr...

AI summary The text references a load forecast from NS Power and mentions the removal of future DSM influences from the load forecast, citing a document filed in April 2019. It also references EfficiencyOne's comments on the 2020 IRP Draft Assumptions and Analysis Plan.

Nova Scotia Power IRP Final Report Appendix H Page 222 of 321 EfficiencyOne Comments M08929 - NS Power 2020 IRP - Draft Assumptions and Analysis Plan

AI summary This document references EfficiencyOne's comments on Nova Scotia Power's 2020 Integrated Resource Planning (IRP) Final Report, specifically Appendix H, Page 222 of 321, and is related to matter number M08929.

1 Canadian utility, namely through work undertaken by BC Hydro in 2011, which may be useful to 2 review.8 3 4 In addition, EfficiencyOne has reviewed the base load forecast NS Power presented in slide 8 of 5 the assumptions set, and has th...

AI summary EfficiencyOne raises questions about modifications to the 2019 load forecast used in the Integrated Resource Plan (IRP) and requests clarification on whether embedded DSM has been removed from the 'Before DSM' scenario. It also challenges the notion of DSM as a 'risky' resource, arguing that it can mitigate supply-side risks.

elow: 25 “DSM evolved during the 1970s as economic, political, social, technological, and 26 resource supply factors combined to change the electricity sectors’ operating 27 environment and its outlook for the future. Ever since then there...

AI summary The text discusses the evolution of Demand-Side Management (DSM) during the 1970s, influenced by economic, political, and technological factors, and references a document from BC Hydro and Nova Scotia Power's Integrated Resource Planning (IRP) process.

Nova Scotia Power IRP Final Report Appendix H Page 223 of 321 EfficiencyOne Comments M08929 - NS Power 2020 IRP - Draft Assumptions and Analysis Plan

AI summary The document references EfficiencyOne's comments on Nova Scotia Power's 2020 Integrated Resource Planning (IRP) Final Report, specifically Appendix H, page 223 of 321, and relates to matter number M08929.

1 producers and energy service providers, and regulatory and consumer concern 2 about rising prices. DSM has been viewed as an effective way of mitigating these 3 risks when it was invented and still viewed so today.”9 4 5 NERC also provid...

AI summary The text discusses the role of Demand-Side Management (DSM) in mitigating energy price risks and improving system reliability. It highlights DSM's benefits in reducing supply-side and transmission requirements, as well as its use in long-term planning and managing risks associated with traditional and renewable resources. EfficiencyOne requests that DSM variability be considered in sensitivity analyses and resource planning.

encyOne assumes that significantly 26 different scenarios such as this one will produce a broad range of transmission and 27 distribution costs which should be considered in the overall cost of each study. 28 9 Gellings, Clark, Evolving pr...

AI summary The text discusses the impact of different scenarios on transmission and distribution costs, referencing studies on demand-side management and reliability. It also mentions Nova Scotia Power's Integrated Resource Planning (IRP) report and a related proceeding.

Nova Scotia Power IRP Final Report Appendix H Page 224 of 321 EfficiencyOne Comments M08929 - NS Power 2020 IRP - Draft Assumptions and Analysis Plan

AI summary Nova Scotia Power's Integrated Resource Planning (IRP) Final Report Appendix H includes comments from EfficiencyOne on the Draft Assumptions and Analysis Plan for the 2020 IRP proceeding.

e DR cases as a resource option (or some DR options as resource options, 23 some as load modifiers). 24 25 EfficiencyOne recommends the following: 26 • modelling the three DR Potential Study cases as load modifiers throughout the 27 entire...

AI summary EfficiencyOne recommends modeling demand response (DR) cases as load modifiers in the Integrated Resource Planning (IRP) analysis. Additional questions are raised regarding stochastics, end effects, and modeling of Municipal Electric Utilities (MEUs) in the IRP model.

Attachment A: Comments from Energy Futures Group Date: February 14, 2020 Nova Scotia Power IRP Final Report Appendix H Page 227 of 321 energyfuturesgroup.com NSP 2020 IRP Draft Analysis Plan 1. How NSP will use E3’s RESOLVE model in combin...

AI summary Energy Futures Group raises concerns about Nova Scotia Power's use of multiple modeling tools in its Integrated Resource Planning (IRP) process, questioning the rationale for using both PLEXOS LT Plan and RESOLVE, the method for combining their results, and the necessity of an additional operability screening step.

edule. We’d like to clarify that this is still indeed what NS Power intends to do and, if so, clarify why the “operability screening” is a necessary additional step. 3. Release of modeling information Does NSP plan to provide modeling info...

AI summary The document raises concerns about the lack of clarity in NS Power's evaluation criteria for the Integrated Resource Plan (IRP), suggesting that assigning weights and color codes is arbitrary and should be avoided. It also questions the timing and process for sharing modeling information with stakeholders.

Nova Scotia Power IRP Final Report Appendix H Page 228 of 321 energyfuturesgroup.com the modeling. In order to ensure clarity on the meaning of the metrics we also seek more information regarding the 10 year NPV Revenue Requirement to look...

AI summary The text discusses concerns regarding the Integrated Resource Planning (IRP) process, including the need for more detailed revenue requirement analysis, the importance of modeling avoided costs for DSM, and the need for flexibility in modeling supply-side additions. It also raises questions about natural gas pricing assumptions in the 2020 IRP draft.

e by modeling new resources in small chunks, e.g. 10 – 25 MW or by iterating runs to arrive at the portfolio that least overbuilds NSP’s system. NSP 2020 IRP Draft Assumptions 6. Natural gas pricing We’re interested in some additional spec...

AI summary The document discusses NSP's 2020 Integrated Resource Plan (IRP) assumptions, focusing on natural gas pricing and modeling approaches. Stakeholders are asking for transparency in gas price forecasts, including seasonal variations and the use of New England prices as a benchmark.

Nova Scotia Power IRP Final Report Appendix H Page 229 of 321 EfficiencyOne Comments NS Power 2020 IRP - Draft Scenarios Document and E3 Pathways Document

AI summary This document references EfficiencyOne's comments on Nova Scotia Power's 2020 Integrated Resource Planning (IRP) report, specifically addressing the Draft Scenarios Document and E3 Pathways Document. It is part of the IRP Final Report Appendix H.

1 Introduction 2 On February 14th, 2020, NS Power released a study conducted by Energy+Environmental 3 Economics (“E3”) titled “Deep Decarbonization in Nova Scotia: Phase 1 Report”, as well as a 4 document titled “Draft Scenarios & Modelin...

AI summary EfficiencyOne submitted comments on two documents released by NS Power, including a decarbonization study and a draft scenarios document. EfficiencyOne recommends that NS Power avoid quantitative comparisons of revenue requirements across electrification scenarios due to incompatibility and select a preferred resource plan based on likelihood.

t effective EE and DR in the 2019 DSM 27 Potential Study are likely underestimated for the electrification scenarios being considered 28 in the IRP, as E1’s Potential Studies are based on levels of electrification assumed in NS 29 Power’s...

AI summary EfficiencyOne comments on Nova Scotia Power's 2020 Integrated Resource Planning (IRP) draft scenarios and E3 Pathways Document, suggesting that the potential for energy efficiency (EE) and demand response (DR) in the 2019 DSM study may be underestimated due to assumptions in the load forecast.

Nova Scotia Power IRP Final Report Appendix H Page 230 of 321 EfficiencyOne Comments NS Power 2020 IRP - Draft Scenarios Document and E3 Pathways Document

AI summary Nova Scotia Power's Integrated Resource Planning (IRP) Final Report Appendix H includes EfficiencyOne's comments on the 2020 IRP Draft Scenarios Document and E3 Pathways Document.

1 8. Enhanced analysis take place for EE and DR combinations contained within high- 2 performing Candidate Resource Plans, with the consultation of EfficiencyOne. 3 9. NS Power confirm EfficiencyOne’s understanding of how T&D avoided costs...

AI summary EfficiencyOne and NS Power are discussing the need for enhanced analysis of electrification scenarios within high-performing Candidate Resource Plans, particularly in the context of NS Power’s 2020 Integrated Resource Plan (IRP). NS Power plans to model various levels of electrification without considering related utility costs, and EfficiencyOne agrees with examining higher levels of electrification due to uncertainty around GHG regulations.

any related utility costs. The electrification scenarios developed in E3’s 26 Decarbonization study are essentially “scenarios” within which NS Power will explore different 27 generation, energy efficiency (EE) and demand response (DR) res...

AI summary The document discusses the development of electrification scenarios by NS Power in their Decarbonization study, highlighting that utility costs of electrification are not included in the Revenue Requirement. This makes quantitative comparison of revenue requirements between different CRPs inappropriate. EfficiencyOne agrees with Synapse on this point.

Nova Scotia Power IRP Final Report Appendix H Page 231 of 321 EfficiencyOne Comments NS Power 2020 IRP - Draft Scenarios Document and E3 Pathways Document

AI summary The document discusses EfficiencyOne's comments on Nova Scotia Power's 2020 Integrated Resource Planning (IRP) final report, specifically addressing the draft scenarios document and E3 Pathways Document.

1 problematic across different electrification scenarios, as the partial revenue requirements will 2 exclude any electrification program administration and incentive costs as well as transmission and 3 distribution costs, which are expecte...

AI summary EfficiencyOne highlights that comparing revenue requirements across different electrification scenarios is problematic due to varying costs, including administration, transmission, distribution, and external incentives. It recommends avoiding quantitative comparisons and selecting a single lowest-cost plan for DSM purposes, emphasizing the importance of a single Preferred Resource Plan (PRP) for IRP activities.

, there will essentially be three PRPs, with each representing the highest- 25 ranking Candidate Resource Plan within each of the three electrification scenarios. NS Power has 26 committed to ultimately choosing a single 25-year Revenue Re...

AI summary EfficiencyOne raises concerns about the lack of clarity in Nova Scotia Power's decision-making criteria for selecting a single 25-year Revenue Requirement minimized plan among three PRPs, which are based on different electrification scenarios.

Nova Scotia Power IRP Final Report Appendix H Page 232 of 321 EfficiencyOne Comments NS Power 2020 IRP - Draft Scenarios Document and E3 Pathways Document

AI summary Nova Scotia Power's IRP Final Report Appendix H includes EfficiencyOne's comments on the 2020 IRP Draft Scenarios Document and E3 Pathways Document, discussing integrated resource planning and demand-side management strategies.

1 With this issue in mind, EfficiencyOne recommends that: 2 3 • NS Power select one electrification scenario on the basis of perceived likelihood of 4 each scenario occurring. This determination should be made by NS Power and E3, with 5 op...

AI summary EfficiencyOne recommends that NS Power select an electrification scenario based on likelihood, with input from stakeholders, and then choose a PRP from that scenario. They also request clarification on modifying the 2019 Load Forecast to account for electrification effects and seek confirmation on understanding the E3 Pathways Report.

ecommendations, EfficiencyOne requests confirmation of its 30 understanding on the following points: 31 Date: March 6, 2020 Page 4 of 9 Nova Scotia Power IRP Final Report Appendix H Page 233 of 321 EfficiencyOne Comments NS Power 2020 IRP...

AI summary EfficiencyOne is requesting confirmation on its understanding of certain points related to Nova Scotia Power's 2020 Integrated Resource Planning (IRP) Final Report and associated documents.

Nova Scotia Power IRP Final Report Appendix H Page 233 of 321 EfficiencyOne Comments NS Power 2020 IRP - Draft Scenarios Document and E3 Pathways Document

AI summary This document includes EfficiencyOne's comments on Nova Scotia Power's 2020 Integrated Resource Planning (IRP) Final Report, specifically addressing the Draft Scenarios Document and E3 Pathways Document.

1 • The E3 Pathways Study is agnostic toward the level of costs, mechanisms (i.e. policy 2 designs), and delivery entity/ies for electrification scenarios. 3 4 5 3.0 Treatment of EE and DR in Draft Scenarios and Modelling Plan 6 7 As evide...

AI summary The document discusses the treatment of energy efficiency (EE) and demand response (DR) in the Integrated Resource Plan (IRP), highlighting inconsistencies in modeling approaches. The E3 Pathways Study is agnostic to costs and mechanisms, while the 2020 IRP provides the first opportunity to evaluate DR systematically. EfficiencyOne's 2019 studies assumed a single electrification forecast, whereas E3's Decarbonization study allowed more variable parameters.

ired with high levels of electrification. However, NS Power’s intent is to extract only 28 the electrification impacts from the study for use in the IRP model as load modifiers. These 29 electrification scenarios, which all require very “s...

AI summary NS Power intends to use electrification impacts from a study in the IRP model as load modifiers, emphasizing the need for significant energy efficiency to meet electrification scenarios.

Nova Scotia Power IRP Final Report Appendix H Page 234 of 321 EfficiencyOne Comments NS Power 2020 IRP - Draft Scenarios Document and E3 Pathways Document

AI summary The document contains comments from EfficiencyOne on Nova Scotia Power's 2020 Integrated Resource Planning (IRP) draft scenarios and E3 Pathways Document, which are part of the IRP Final Report Appendix H.

1 net zero 2050 targets, will be paired in the IRP model with the EE & DR scenarios from 2 EfficiencyOne’s potential study, which were all based on much lower levels of electrification. 3 EfficiencyOne understands NS Power will also requir...

AI summary The text discusses the integration of electrification, energy efficiency (EE), and demand response (DR) scenarios in the Integrated Resource Planning (IRP) model for Nova Scotia Power. It highlights concerns that current models may not fully account for the interactive effects between these factors, potentially leading to suboptimal outcomes in achieving net-zero and GHG reduction targets.

E & DR Scenarios with CRPs 24 It is important to recognize the number of possible solutions has gone from three in the 2014 IRP 25 (Low-Low, Base, High), to 16 in the 2020 IRP, accounting for differing combinations of DR and 26 EE. The exi...

AI summary The text discusses the expansion of scenarios in the 2020 Integrated Resource Plan (IRP) from three in 2014 to 16, incorporating combinations of demand response (DR) and energy efficiency (EE). EfficiencyOne emphasizes the importance of exploring these scenarios, despite challenges, as they will inform future demand-side management (DSM) decisions and avoided costs.

No New Emitting Mid High Resources 1A-2 Comparator Current Landscape Mid High 2C-2 Net Zero – High Electrification Regional Mid High Integration Date: March 6, 2020 Page 7 of 9 Nova Scotia Power IRP Final Report Appendix H Page 236 of 321...

AI summary The document discusses Nova Scotia Power's Integrated Resource Planning (IRP) Final Report and related efficiency comments, focusing on scenarios and pathways for achieving energy efficiency and net zero goals. It includes references to EfficiencyOne's feedback on the draft documents.

Nova Scotia Power IRP Final Report Appendix H Page 236 of 321 EfficiencyOne Comments NS Power 2020 IRP - Draft Scenarios Document and E3 Pathways Document

AI summary The document includes EfficiencyOne's comments on Nova Scotia Power's 2020 Integrated Resource Planning (IRP) Final Report, specifically addressing the Draft Scenarios Document and E3 Pathways Document.

4C-2 Net Zero – Moderate Regional Mid High Electrification Integration 1 2 EfficiencyOne developed the above pairings with a focus on generally exploring differing levels 3 of EE and DR, while at the same time suggesting pairings that may...

AI summary EfficiencyOne recommends specific EE and DR pairings for analysis and suggests enhanced exploration of optimal levels within high-performing Candidate Resource Plans. NS Power agrees to address T&D avoided costs as part of the IRP process, with stakeholder involvement.

d consider the development of an approach 26 and alternate methodology than currently exists for the calculation. This process will occur in 27 parallel with the IRP and will conclude during the course of the IRP. EfficiencyOne appreciates...

AI summary EfficiencyOne comments on Nova Scotia Power's 2020 Integrated Resource Plan (IRP), emphasizing the need for an improved methodology to calculate avoided transmission and distribution costs. They note that these costs will not be included in the IRP model and stress the importance of accurate avoided cost assessments for planning decisions.

Friis, Regulatory Affairs Officer/Clerk Nova Scotia Utility and Review Board 3rd Floor, 1601 Lower Water Street Halifax, Nova Scotia B3J 3S3 Via email: [email protected] February 14, 2020 Re: M08929 – Integrated Resource Planni...

AI summary Envigour Policy Consulting Inc., acting on behalf of QUEST and Marine Renewables Canada, supports Nova Scotia Power’s approach to Integrated Resource Planning (IRP) but raises concerns regarding assumptions about the future costs of instream tidal energy and the evolving value of offshore wind. The submission outlines areas where the modelling should reflect different assumptions and highlights QUEST’s research on the emerging role of Distributed Energy Resources (DER).

rmore, the underpinning of the NS Power consultant’s assumptions that tidal technology deployed and to be deployed in Nova Scotia is equivalent to a custom-designed hydro project is in fact erroneous. Furthermore, although any and all pred...

AI summary The text critiques the assumption that tidal technology is equivalent to a custom-designed hydro project and highlights the potential value of offshore wind technology, particularly with advancements in turbine capacity factors. It suggests using a lower CAPEX figure for tidal projects and emphasizes the importance of capturing the full value of offshore wind in the Integrated Resource Plan (IRP).

ant could provide explicit assurance the modelling will capture the value of such a high capacity factor. 9 https://www.ge.com/renewableenergy/wind-energy/offshore-wind/haliade-x-offshore-turbine Envigour Memo Februray 18, 2020 Page 5 of 1...

AI summary The document discusses the rapid innovation in energy technologies driven by the need to reduce carbon emissions and develop cost-effective solutions. It highlights the role of distributed energy resources such as energy efficiency, renewable energy, energy storage, and microgrids in transforming energy systems.

of adoption. The possible pace of change can be seen in the evolution of the iPod into the iPhone into the more general smartphone and the explosion of applications over the course of just one decade. The needs of the market may change as...

AI summary The text discusses the rapid evolution of technology and its impact on energy markets, highlighting how changing consumer behavior and increasing grid stress due to variable weather conditions are shifting the focus toward resiliency, reliability, and distributed storage solutions. Traditional top-down planning approaches are being challenged by bottom-up consumer-driven energy choices.

Envigour Memo Februray 18, 2020 Page 6 of 13 Nova Scotia Power IRP Final Report Appendix H Page 244 of 321 We also need a great deal more information on the value of new and evolving technologies. As we noted in our earlier filing for this...

AI summary The text discusses the need for more information on the value of new technologies in energy planning, particularly storage solutions like hydrogen from renewable energy. It also emphasizes the importance of considering climate change in energy planning, noting Nova Scotia's net-zero by 2050 goal and the role of electrification in achieving it.

immune. In fact, most likely pathways to achieving this goal depend upon a significant amount of electrification and thus the assumption that the electricity will be net-zero carbon logically follows. While there can and will be considerab...

AI summary The text discusses the implications of achieving net-zero carbon emissions through electrification and the challenges of energy poverty. It highlights the potential for inequality as those with capital invest in energy systems, leaving low-income individuals behind. It also outlines principles for risk reduction in Integrated Resource Planning (IRP) under conditions of rapid change.

o account, and not simply leave it in the hands of taxpayers to resolve. Principles for Risk Reduction in IRP Under conditions of rapid and disruptive change several principles regarding risk emerge: First and foremost, all other things be...

AI summary The text discusses principles for risk reduction in Integrated Resource Planning (IRP), emphasizing the importance of flexible and adaptive investments with shorter payback periods. It argues that long-term investments, such as 15 to 20-year power purchase agreements (PPAs), may be less economical than anticipated, while investments in carbon-emitting resources are generally riskier than those in renewable energy technologies.

This principle is not absolute - a case may be made for “peaker” natural gas generators especially ones that could be converted to hydrogen or use a combination of hydrogen and renewable natural gas. A risk-adverse planning framework would...

AI summary The text discusses the importance of embracing DER and net-zero goals in the IRP, emphasizing that scenarios relying on carbon-emitting resources beyond 2050 are risky and imprudent. It highlights the need to support customer choice and satisfaction through DER, which offers short-term paybacks and resiliency.

be ignored or rejected when considering only lowest-cost compliant scenarios. Ones that include DER should be preferred against ones that do not, especially when the levelized costs are not far apart. After the IRP The IRP assumptions need...

AI summary The text emphasizes the importance of incorporating DER in integrated resource planning (IRP) and updating IRP assumptions regularly through expert input. It also highlights the need for testing programs and strategies to develop evidence for DER's value and support pilots to reduce energy poverty. Smart energy communities and their policy development are also referenced.

ng on distributed energy resources and the opportunity to support the development of smart energy communities. The detailed technical and policy thinking behind their work is attached to this report. Envigour Memo Februray 18, 2020 Page 8...

AI summary The text discusses the concept of Smart Energy Communities, emphasizing the integration of local, renewable, and conventional energy sources to meet energy needs in an efficient, clean, and affordable manner. It highlights the importance of aligning energy policy with community priorities and land use planning.

nities to make assets out of local waste (domestic, agricultural or industrial) or diverse local renewable energy options. Smart Energy Communities figure this out and select what works best for them. 3) Maximizing the value of all our ass...

AI summary The text discusses the importance of Smart Energy Communities in leveraging local waste and renewable energy, maximizing existing infrastructure value, and emphasizing institutional innovation in energy systems. It highlights the need for careful planning and regulatory adaptation to support technological advancements and community-driven energy solutions.

re, balance • Ensuring right source - right place - right time • Energy reliability, security, planning • Existing robust systems • Who managing distributed sources - management models Distribution Consumer Challenges (Muni’s, institutions...

AI summary The text discusses challenges faced by distribution consumers, including understanding technologies, energy project development, business models, and policy restrictions. It also highlights challenges for developers and solution providers, such as understanding municipal processes, identifying solutions, and timing of funding programs. A memo and appendix from Nova Scotia Power's IRP Final Report are referenced, along with a communication from Hydrostor regarding advanced compressed air energy storage.

Power IRP Final Report Appendix H Page 253 of 321 To: Nova Scotia Power (NSP) – Integrated, Resource Planning Team From: Jon Sorenson, Hydrostor Re: Advanced Compressed Air Energy Storage (A-CAES) As communicated on our teleconference, Hyd...

AI summary Hydrostor is proposing its Advanced Compressed Air Energy Storage (A-CAES) technology to Nova Scotia Power as a solution for balancing the grid as the company retires assets and increases reliance on intermittent renewable energy sources.

hnical Inputs Summary January 2020 Nova Scotia Power IRP Final Report Appendix H Page 255 of 321

AI summary This document is a technical inputs summary from Nova Scotia Power's Integrated Resource Planning (IRP) Final Report, dated January 2020. It is part of Appendix H and appears on page 255 of 321.

ii Nova Scotia Power IRP Final Report Appendix H Page 257 of 321

AI summary This document is a page reference from the Nova Scotia Power Integrated Resource Planning (IRP) Final Report Appendix H, indicating the page number within a larger report.

vi Nova Scotia Power IRP Final Report Appendix H Page 261 of 321

AI summary The text is a page reference from an appendix of Nova Scotia Power's Integrated Resource Planning (IRP) Final Report. It does not contain any substantive content or discussion relevant to the proceeding.

rried out to determine viability. More information about the requirements of an exploratory drilling program can be found in the data room. Available data sources may include but are not limited to: 3 Nova Scotia Power IRP Final Report App...

AI summary The text discusses geotechnical considerations for cavern construction, including overburden thickness and preferred rock types. It highlights that minimal overburden is preferred, and hard-rock geology is favored for structural stability. Feasibility is influenced by factors such as soil composition and cavern placement in consolidated rock.

Nova Scotia Power IRP Final Report Appendix H Page 269 of 321 Natural Forces Services Inc. 1801 Hollis Street Suite 1205 Halifax NS B3J 3N4 T: (902) 422 9663 F: (902) 422 9780 Doreen Friis, February 14, 2020 Regulatory Affairs Officer/Cler...

AI summary Natural Forces Services Inc. comments on the 2020 Integrated Resource Plan, noting that demand projections assume significant demand regression due to DSM/efficiency measures, but also highlights the potential for increased electricity demand from electrification of transport and heat sectors.

omes a vehicle to assist decarbonisation of the transport and heat sectors). Increased electrification of the transport and heat sectors has the potential to significantly increase electricity demand. It is also important in general in an...

AI summary The text discusses the importance of considering a wide range of demand projections in an Integrated Resource Plan (IRP) to ensure robustness of portfolio outcomes. It also highlights the need to recognize the value of additional emissions savings beyond current legislative requirements and to account for risk premiums associated with different scenarios.

ated with different scenarios. For example, scenarios which rely on new/unproven technology, or very ambitious DSM achievements, may carry additional risk regarding implementation and risk of failure. Operational Constraints associated wit...

AI summary The text discusses the importance of modeling operational constraints in the Integrated Resource Plan (IRP) process, particularly for renewable integration. Key grid services such as ramping reserve, system strength, and reactive support are identified as essential to ensure system stability and security when integrating renewable resources.

model to integrate renewable resources at any level by ensuring provision of the services. 2 Page Natural Forces Memo February 14, 2020 Page 2 of 4 Nova Scotia Power IRP Final Report Appendix H Page 271 of 321 We suggest inclusion of VAR s...

AI summary The document suggests reconsidering the inclusion of VAR support as a binding constraint in the Integrated Resource Plan (IRP) model, noting that it can often be resolved with low-cost solutions. It also highlights concerns about using the Stability Study for determining grid service requirements due to its focus on extreme scenarios rather than normal conditions.

there may be learnings that can be taken from it, care must be applied as the scenarios modelled in the Stability Study do not reflect “normal” system conditions and normal grid service requirements. We would appreciate further understandi...

AI summary The text discusses the importance of setting appropriate limits for Grid Services in the Integrated Resource Plan (IRP) model, emphasizing the need for caution in modeling scenarios that do not reflect normal grid conditions. It highlights opportunities for existing and new generation plants, as well as renewable sources, to contribute to grid services and the potential of demand-side contributions to short-term reserves.

aboration. We look forward to working closely with you in the continuing stages of the IRP process. Sincerely, Presented for, and on behalf of, Natural Forces Services Inc. Halifax, Nova Scotia. 4 Page Natural Forces Memo February 14, 2020...

AI summary The Small Business Advocate (SBA) raised concerns regarding the treatment of Demand Side Management (DSM) in Nova Scotia Power's Integrated Resource Plan (IRP) analysis, suggesting that DSM is being considered as an exogenous factor rather than an integrated resource option.

portfolio optimization process, but rather the DSM sc_enarios that change the load that will be used as inputs to the model used to develop the portfolios. The concern of using this approach is that: I. It does not test the economics of th...

AI summary The text discusses concerns with the methodology used in Nova Scotia Power's Integrated Resource Plan (IRP) regarding Demand Side Management (DSM) scenarios and their impact on portfolio optimization. It highlights issues with the economics of DSM, differences in focus among DSM options, and the dynamic effects of DSM penetration on avoided costs. The text also raises questions about revenue requirements for multi-year amortization.

. There needs to be specificity as to how the revenue requirements will be determined for fillllual expenditures, ie multi-year amortiz.ation. A question that then arises is whether it is a variable. The SBA believes that the incorporation...

AI summary The SBA raises concerns about the revenue requirements for multi-year amortization and the exclusion of distributed generation in the IRP. They emphasize the need for further discussion on DSM and DER integration, as well as the modeling of customer economics and solar policies.

) was revised on February 3, 2020. The revised assumptions included significant changes to the sustaining capital forecast for coal, CT, and small hydro units. ,._ NSPI should provide the original and revised data in tabular f01m so stakeh...

AI summary The Small Business Advocate (SBA) requested Nova Scotia Power Inc. (NSPI) to provide original and revised data on sustaining capital forecasts for coal, CT, and small hydro units in tabular form, along with explanations and supporting studies. This request was made in response to the revised assumptions included in the IRP assumptions on February 3, 2020.

d Resources Plan engagement session. In response to the Assumptions provided on January 21, 2020 and February 3, 2020, we offer the following comments, questions and suggestions: 1. Energy Storage The Verschuren Centre engaged industry par...

AI summary The Verschuren Centre provided feedback on the Nova Scotia Power IRP Final Report, focusing on energy storage and electrification. They emphasized the need to consider all value streams of energy storage systems in the Plexos model and requested more detail on how these will be accounted for.

nergy storage resources (over 100kW) in RTO jurisdictions. Please provide more detail regarding how the various value streams of energy storage will be accounted for in Plexos. 2. Electrification We think it is critically important that th...

AI summary The text emphasizes the importance of electrification in Nova Scotia's Integrated Resource Plan (IRP), citing research that suggests electrification is the most cost-effective pathway to zero emissions. It references energy requirements for transportation and space heating, and highlights the potential of heat pump technology for space heating electrification.

Verschuren Centre Memo February 16, 2020 Page 2 of 6 Nova Scotia Power IRP Final Report Appendix H Page 278 of 321 3. Distribution On its own merits, it is clear that this IRP should take into account substation level capacity consideratio...

AI summary The document discusses the need to consider substation capacity in the Integrated Resource Plan (IRP) due to increased load from electrification. It highlights 34 heavily loaded substations and suggests including thermal energy storage in the IRP to manage future heating and cooling demands and provide flexibility in peak demand periods.

heating, and that electric space heating demands are likely to grow significantly over the next 20-30 years, it makes it clear that there is significant value in having flexibility in that demand. Verschuren Centre Memo February 16, 2020 P...

AI summary The text discusses the potential of thermal storage technologies, highlighting their cost competitiveness and suitability for balancing wind energy with heating demands. It argues that thermal storage should be considered separately in the Integrated Resource Plan (IRP) model due to its unique characteristics and higher Effective Load-Carrying Capability (ELCC).

to discuss any of the topics above in more detail with NSPI and E3. Sincerely, Daniel Roscoe, P.Eng Lead – Renewable Energy Verschuren Centre for Sustainability in Energy and the Environment Verschuren Centre Memo February 16, 2020 Page 5...

AI summary The document references the Nova Scotia Power Integrated Resource Plan (IRP) Final Report and its Appendix H, with a memo from the Verschuren Centre for Sustainability in Energy and the Environment dated February 16, 2020, and participant comments on IRP assumptions dated March 11, 2020. It mentions engagement with NSPI and E3 regarding topics in the report.

Nova Scotia Power IRP Final Report Appendix H Page 282 of 321 IRP Assumptions – Participant Comments March 11, 2020

AI summary The document presents the IRP Final Report Appendix H, which includes participant comments on IRP assumptions as of March 11, 2020. It outlines feedback and discussions related to the Integrated Resource Plan assumptions.

Category Participant Assumption Comment NS Power Response 1. Financial CanWEA/SIA Ensure sensitivities reflect variability of assumptions and Low and High capital cost sensitivities for wind and recognize how modular nature and experience...

AI summary The document discusses financial and load assumptions in a regulatory proceeding, including the need to reflect variability in capital costs for wind and storage technologies, and the inclusion of EV load shape effects in capacity expansion models. NS Power has updated assumptions using recent data and presented a range of load curves informed by studies.

fication scenario modelling to be meeting and have been provided with the final provided to stakeholders for review & comment assumptions set. 1 Nova Scotia Power IRP Final Report Appendix H Page 283 of 321 IRP Assumptions – Participant Co...

AI summary The document discusses the final assumptions provided to stakeholders for review and comment as part of the Integrated Resource Plan (IRP) Final Report, with a focus on scenario modelling and participant feedback.

Nova Scotia Power IRP Final Report Appendix H Page 283 of 321 IRP Assumptions – Participant Comments March 11, 2020

AI summary The document is a section of the Nova Scotia Power Integrated Resource Plan (IRP) Final Report, specifically Appendix H, which includes participant comments dated March 11, 2020. It outlines assumptions made in the IRP process and includes feedback from stakeholders.

cell or other derived source) by 2050 and energy requirements. Reasonable to assume 80-100% of space heating via heat pump by 2050 Space heating load aligned with demand peaks and electrification of space heating presents capacity concerns...

AI summary The text discusses the assumption that 80-100% of space heating will be via heat pumps by 2050, raising concerns about capacity due to electrification. It also requests confirmation on modifying the 2019 Load Forecast by removing 40% of future EE and DR from the 'before DSM' scenario while retaining the impacts of previously delivered programs. NS Power plans to use the Pathways report to adjust the forecast for electrification before EE and DR.

irectly in IRP model. Please refer to NS Power’s Final Assumptions and Scenarios and Modeling Plan. 2 Nova Scotia Power IRP Final Report Appendix H Page 284 of 321 IRP Assumptions – Participant Comments March 11, 2020

AI summary The document references Nova Scotia Power's Final Assumptions and Modeling Plan as part of the Integrated Resource Plan (IRP) process, with comments from participants included in the report. It highlights the ongoing development and analysis of IRP models.

Nova Scotia Power IRP Final Report Appendix H Page 284 of 321 IRP Assumptions – Participant Comments March 11, 2020

AI summary The document is a section of Nova Scotia Power's Integrated Resource Plan (IRP) Final Report, specifically Appendix H, which includes participant comments dated March 11, 2020. It outlines assumptions made in the IRP process and includes feedback from participants.

ario beyond wide range of long-term outcomes in terms of both peak regulatory targets and which models net zero and energy requirements. The Final Scenario and Modeling Plan contains GHG trajectories more stringent than current regulatory...

AI summary The document discusses NSP's approach to handling excess carbon credits and the integration of cap and trade market revenues into the Integrated Resource Plan (IRP) modeling process. It also addresses the consideration of the SDGA in business as usual scenarios and the Comparator scenario's role in the modeling process.

the SDGA Environmental (February considered in business as usual scenario? [comparator and is intended to be informational in nature only. Assumptions 14) scenarios?] 3 Nova Scotia Power IRP Final Report Appendix H Page 285 of 321 IRP Assu...

AI summary The document discusses environmental assumptions in the Integrated Resource Plan (IRP) Final Report, with participants commenting on the impact of the Sustainable Development Goals Act (SDGA) on GHG reductions and air quality regulations. Nova Scotia Power responds by aligning assumptions with Scenario B from the 2014 IRP and notes that GHG trajectories in the Final Scenario are more stringent than current regulatory requirements.

Fed government may require further reductions in cap & trade jurisdictions 3. EAC Consider further Renewable Energy targets and RES A sensitivity to analyze an increased RES standard has Environmental requirements been proposed as part of...

AI summary The text discusses the potential need for further reductions in cap-and-trade jurisdictions and the consideration of enhanced equivalency agreements with the federal government. It also highlights the need for Nova Scotia Power to propose emissions pathways compliant with federal regulations and the inclusion of more stringent GHG reduction scenarios in the Integrated Resource Plan.

Scenarios and Modeling Plan for details. Environmental EAC CO2 pre 2030; 0 by 2040 In the final Modeling Plan NS Power has included a GHG Assumptions 4.5 MT 2030 vs 3.0 – Is equivalency the reason for this? Scenario with limits below 3.0MT...

AI summary The document discusses Nova Scotia Power's Integrated Resource Plan (IRP) and its modeling assumptions, including GHG emission targets. It references a scenario with accelerated net zero by 2045 and questions the reasoning behind specific CO2e emission levels in the final Modeling Plan.

Nova Scotia Power IRP Final Report Appendix H Page 287 of 321 IRP Assumptions – Participant Comments March 11, 2020 Category Participant Assumption Comment NS Power Response 4. Supply Side CA Should include allowance for decommissioning NS...

AI summary Nova Scotia Power's Integrated Resource Plan (IRP) assumptions are discussed, with a focus on decommissioning costs. Participants suggest that decommissioning costs should be included in the full-cost evaluation of supply-side resources. NS Power responds that decommissioning costs are not included in capital cost estimates due to uncertainty and potential for life extensions, salvage value, and repowering.

of the future decommissioning costs for new assets is assumed to be immaterial to the IRP analysis.

AI summary The text states that future decommissioning costs for new assets are assumed to be immaterial to the Integrated Resource Plan (IRP) analysis.

4. Supply Side CA Supply side capacity options should include flexible solar The model will be free to select combinations of Options (Chernick & (for dispatch control for ancillary services) and hybrid renewable generators and energy stor...

AI summary The text discusses supply-side capacity options, emphasizing flexible solar and hybrid renewable-storage resources. It requests more information on NSP's cost assumptions, citing a 2019 study and updates based on 2019 data. Solar PV costs have decreased, and gas costs are expected to be 20% lower.

e updated early in 2020 based on 2019 actual data [and CT] gas costs should be 20% lower per NREL ATB that became available after the original study was completed. Storage technologies O&M should be variable and not fixed; should include c...

AI summary The document discusses updates to gas costs and assumptions related to supply-side technologies in the IRP Final Report. It highlights discrepancies in storage technology O&M costs and the need to combine capex and opex with financing assumptions for accurate revenue requirement profiles.

Explicitly identify LCOE values from E3 Resource Options Study 4. Supply Side Dalhousie Scenarios w/ more grid sharing from provinces w/ hydro NS Power has added a Regional Integration resource Options and micro-grid structures strategy to...

AI summary The document discusses supply-side options for energy generation in Nova Scotia, including regional integration strategies, coal-to-gas conversions, natural gas-fired combined cycle turbines, and compressed air energy storage. NS Power is evaluating these options within the Integrated Resource Plan (IRP) and considering reliability and capital costs.

Side JFS Consider compressed air energy storage (stored in The IRP will consider sensitivities on both Low and High Options Hydrostor underground caverns and released to surface turbine to Capital Cost of Storage which will encompass the r...

AI summary The document discusses considerations for compressed air energy storage and in-stream tidal energy as part of the Integrated Resource Plan (IRP). Hydrostor's cost range for compressed air storage is noted, and concerns are raised about the high assumptions for in-stream tidal energy due to limited industry experience and site-specific costs.

Nova Scotia Power IRP Final Report Appendix H Page 289 of 321 IRP Assumptions – Participant Comments March 11, 2020 Category Participant Assumption Comment NS Power Response 4. Supply Side Envigour No issue with assumption of wind capex de...

AI summary Envigour (Bruce Cameron) comments on Nova Scotia Power's IRP assumptions, noting that while they agree with the decline in wind capex, they highlight the need to consider offshore wind with a higher capacity factor of 63%, which affects capital cost assumptions. Nova Scotia Power responds by referencing the use of CanWEA data in the Supply Options Study.

e the value for offshore wind being used in the IRP. (incl. decrease in levelized cost of energy) of such a high capacity factor.

AI summary The text discusses the value of offshore wind in the Integrated Resource Plan, including a decrease in the levelized cost of energy and a high capacity factor.

4. Supply Side Natural The cost of wind $2100 is 15% higher than Natural Forces The low wind sensitivity included in the final assumption Options Forces experience on slide 35. set is $1500/kW which is in line with the 2019 Lazard low cost...

AI summary The document discusses supply-side options in Nova Scotia, including the cost of wind energy, energy storage, smart grid technologies, EVs, tidal energy, and solar gardens. It highlights challenges in transmission, the need for microgrids, and the lack of modeling for distribution systems in the Integrated Resource Plan.

is in ability to respond quickly w/ no data supplied by the Verschuren Centre in their written ramp rates and provide flexibility as load and generator comments. Model should consider all potential value streams for NS Power will work with...

AI summary The text discusses the need for energy storage systems to provide flexibility and account for all potential value streams, including how they can be stacked. NS Power plans to collaborate with stakeholders during the Integrated Resource Plan (IRP) process to develop a methodology for calculating Avoided T&D Costs associated with storage resources.

Resources Promoted scenario which NS Power has included in the Modeling Plan.

AI summary The document refers to a 'Resources Promoted scenario' included in the Modeling Plan by NS Power. This scenario is part of a broader planning effort, though details about the scenario's specifics or implications are not provided in the text.

Storage in PLEXOS allows these resources to provide capacity, energy, and operating reserves. Charging cost is calculated in the production model dynamically. Battery Storage contributions to essential grid services will be considered both...

AI summary The text discusses battery storage contributions to grid services within the PLEXOS model and mentions the E1 Potential Study related to supply-side options under the Regional Integration resource strategy, including assumptions about access to firm capacity via new transmission up to 800 MW and associated costs.

Nova Scotia Power IRP Final Report Appendix H Page 291 of 321 IRP Assumptions – Participant Comments March 11, 2020

AI summary This document is a page from the Nova Scotia Power Integrated Resource Plan (IRP) Final Report Appendix H, dated March 11, 2020, which outlines participant comments on IRP assumptions. It provides insights into stakeholder feedback regarding the assumptions made in the IRP.

Category Participant Assumption Comment NS Power Response 5. DER CA DER should include full cost of resources (and not just The IRP evaluates the costs and benefits of utility (Distributed (Chernick & portion paid by NSP incentives) and re...

AI summary The text discusses the inclusion of full resource costs in DER evaluations, the consideration of non-energy benefits, and the impact of declining DER technology costs. NS Power responds by explaining how the IRP evaluates costs and benefits, and agrees on the declining cost trajectory of DERs.

istributed Resources scenario will provide (Distributed because won’t be selected by model due to cost is a information as to the potential impacts of these Energy shortcoming. Needs to be recognition of existence of technologies will have...

AI summary The text discusses the integration of distributed energy resources (DER) in Nova Scotia Power's Integrated Resource Plan (IRP), including the need to evaluate BTM thermal energy storage, the economic signals influencing customer adoption of DER, and the impact of DER on peak energy requirements. It also highlights the cost competitiveness of energy thermal storage (ETS) and the importance of testing solar ratemaking and net metering policies.

va Scotia Power IRP Final Report Appendix H Page 292 of 321 IRP Assumptions – Participant Comments March 11, 2020

AI summary The document is a section of the Nova Scotia Power Integrated Resource Plan (IRP) Final Report, specifically Appendix H, which includes participant comments dated March 11, 2020. This section likely contains feedback or input from stakeholders regarding the assumptions made in the IRP.

at reliability obligations (i.e. 0.1 Adjustments; ICAP method results in a PRM of 20%; UCAP days/year LOLE) are maintained in all years of the plan; method results in a PRM of 7%to 9%. Dynamic under will iterate if required. capacity expan...

AI summary The text discusses planning reserve margin assumptions in the Integrated Resource Plan (IRP), including reliability obligations, capacity expansion strategies, and the need to revisit hydro ELCC assumptions. It also references a request to make numerical values from Figure 27 visible.

Nova Scotia Power IRP Final Report Appendix H Page 293 of 321 IRP Assumptions – Participant Comments March 11, 2020

AI summary This document is part of Nova Scotia Power's Integrated Resource Plan (IRP) Final Report, specifically Appendix H, which includes participant comments dated March 11, 2020. It outlines assumptions made in the IRP and includes feedback from participants.

ces peak and energy assumptions are significantly different affecting load shape than the 2018 actuals on which the load shape is based. 6. Planning CA Forecast marginal ELCC values may be missing diversity The diversity benefit to ELCC wi...

AI summary The document discusses concerns about load shape assumptions and ELCC values in the Integrated Resource Plan (IRP) analysis. It highlights the need for more detailed methods and diagnostic outputs for the capacity value study, including how hourly loads relate to weather data and long-term weather trends.

weather & load (temp, wind, humidity, precipitation) • What consideration of long-term weather trends (> wind, what about precipitation) • Weather conditions (temp) correlated with outages, efficiency (heat rate) or capacity? 12 Nova Scoti...

AI summary The text discusses considerations of long-term weather trends, specifically wind and precipitation, and their correlation with outages, efficiency (heat rate), and capacity in the context of Nova Scotia Power's Integrated Resource Plan (IRP) assumptions and participant comments.

8. DSM E1 Confirm avoided DSM costs: • Confirmed that avoided energy and capacity will (February • Avoided energy & capacity will be output be output 14) • Avoided T&D costs will be input, using values based on • Avoided T&D costs will not...

AI summary The document discusses the confirmation of avoided DSM costs, including energy, capacity, and T&D costs, and their inclusion in the Integrated Resource Plan (IRP). It also addresses the use of DSM amounts from the 2020-2022 supply agreement and the consideration of cost-effective energy efficiency and demand response levels from the Potential Study in the IRP.

come from (February initiatives, and market developments are part of the a variety of sources. The IRP is agnostic as to the 14) before DSM load forecast provider. The DSM Potential Study is being used for EE and DR potential assumptions;...

AI summary The Integrated Resource Plan (IRP) is agnostic regarding the provider of demand-side management (DSM) load forecast initiatives. The DSM Potential Study is used for energy efficiency (EE) and demand response (DR) potential assumptions, though actual delivery may come from various sources.

Nova Scotia Power IRP Final Report Appendix H Page 295 of 321 IRP Assumptions – Participant Comments March 11, 2020 Category Participant Assumption Comment NS Power Response 8. DSM E1 Confirm whether NSP using 2019 “Before DSM” load Confir...

AI summary The document discusses participant comments and responses from Nova Scotia Power regarding the Integrated Resource Plan (IRP) assumptions, particularly focusing on Demand Side Management (DSM) scenarios and load forecasts. E1 requested clarification on the use of the 2019 'Before DSM' load forecast and modifications made to it for the IRP. Nova Scotia Power confirmed the use of the forecast and provided details on how embedded DSM was accounted for in the assumptions.

comparison is the same when the various E1 DSM scenarios are subtracted out. The Potential study scenarios have not been modified other than shift for DSM activity 2021-2022 and the above noted modification. These details have now been inc...

AI summary The document discusses the exclusion of DSM variability from supply-side risk sensitivity in the E1 DSM scenarios. It notes that the Potential study scenarios have been modified to account for DSM activity from 2021-2022, and NS Power will follow up with E1 to better understand this suggestion.

Nova Scotia Power IRP Final Report Appendix H Page 296 of 321 IRP Assumptions – Participant Comments March 11, 2020 Category Participant Assumption Comment NS Power Response 8. DSM SBA Treating DSM as load modifier and only considering low...

AI summary The Small Business Advocate (SBA) comments on the treatment of Demand Side Management (DSM) in the Integrated Resource Plan (IRP) assumptions. The SBA argues that DSM should be considered an integrated resource option rather than an exogenous factor. Nova Scotia Power acknowledges the comment and notes that the data from the Potential Study supports treating DSM as a load modifier.

of DSM program implementation efforts will not be output of IRP optimization, but DSM scenarios that change load will be used as model inputs. Concerns with this approach: • Economics of different DSM amounts not tested • Doesn’t look at p...

AI summary The text discusses concerns with using DSM scenarios as model inputs rather than outputs of IRP optimization. It highlights that this approach does not test the economics of different DSM amounts, does not account for differences in focus (peak reduction vs. energy reduction), and does not capture dynamic effects between DSM penetration and avoided cost. The SBA argues that treating DSM as a load modifier enables quantification of avoided costs and that varying DSM programming affects capacity expansion plans and costs.

plans with different fuel and power purchase costs and distinct avoided DSM costs. 8. DSM SBA Some EE measures encourage electrification and could NS Power agrees. Efficient electrification is captured increase load – not clear whether cap...

AI summary The discussion focuses on the treatment of demand-side management (DSM) costs and revenue requirements in the Integrated Resource Plan (IRP) modeling. The SBA raises concerns about the methodology for capturing electrification impacts and the need for specificity in how annual DSM expenditures are amortized over time.

Nova Scotia Power IRP Final Report Appendix H Page 297 of 321 IRP Assumptions – Participant Comments March 11, 2020 Category Participant Assumption Comment NS Power Response 9. Demand E1 Each market potential case for DR should be treated...

AI summary Nova Scotia Power's Integrated Resource Plan (IRP) Final Report Appendix H discusses participant comments on demand response assumptions. E1 suggested that each market potential case for demand response should be treated as a separate trajectory for spending and savings. NS Power responded by aggregating E1’s demand response programs into one trajectory for each case and modeling the DR Potential Study cases as resource options.

gas (and cost of meeting emission limits) or (with REC / carbon price) and non-emitting sourced Wilson) ignore economic imports of fossil generation imports 12. Fuel Pricing CA Confirm if model selects new gas units, supply per option Conf...

AI summary The document discusses fuel pricing and assumptions related to gas generation in the context of the Integrated Resource Plan (IRP). It references the confirmation of model selections for new gas units and their capacity factors, specifically combined cycle units, under the IRP.

cotia Power IRP Final Report Appendix H Page 298 of 321 IRP Assumptions – Participant Comments March 11, 2020

AI summary The document is a page from the Nova Scotia Power Integrated Resource Plan (IRP) Final Report, specifically Appendix H, which contains participant comments on IRP assumptions. The page number and date are provided, indicating the context of the proceeding.

metric for all units (e.g., 80% capacity factor). Thus, if the IRP results forecast relatively low utilization factors for some units, compared to the historical base, NS Power would expect future capital investments to be lower than the b...

AI summary The text discusses how Nova Scotia Power expects future capital investments to be lower than those assumed in the Integrated Resource Plan (IRP) if the IRP results forecast relatively low utilization factors for some units, compared to historical data.

ed to the historical base, NS Power would expect future capital investments to be lower than the base assumptions included in the IRP.

AI summary The text discusses NS Power's expectation that future capital investments will be lower than the base assumptions included in the Integrated Resource Plan (IRP), based on historical data.

13. Sustaining CA Are IRP and 2020 ACE sustaining capital forecasts based Yes. The ACE Plan is based on the annual bottom-up view Capital (Chernick & on different UF? Does sustaining capital for each unit and projected utilization, whereas...

AI summary The discussion centers on sustaining capital forecasts for the Integrated Resource Plan (IRP) and the 2020 ACE Plan. The ACE Plan uses annual bottom-up views and projected utilization, while the IRP uses a high utilization factor (UF) method. Sustaining capital estimates are presented in real 2020 dollars, with inflation included in modeling. Heritage Gas requests a review of sustaining capital costs from slide 95, noting a change in the vertical axis from nominal to real dollars.

original (Jan 20) assumptions set; explain reflects basis of presentation (nominal to real dollars) changes, esp. in light of revisions to vertical axis. 17 Nova Scotia Power IRP Final Report Appendix H Page 299 of 321 IRP Assumptions – Pa...

AI summary This section of the Nova Scotia Power IRP Final Report Appendix H discusses assumptions made in the presentation, particularly the transition from nominal to real dollars and changes reflected in the vertical axis of the report.

ova Scotia Power IRP Final Report Appendix H Page 299 of 321 IRP Assumptions – Participant Comments March 11, 2020

AI summary The document is a section of the Nova Scotia Power Integrated Resource Plan (IRP) Final Report, specifically Appendix H, which includes participant comments from March 11, 2020. It outlines assumptions and feedback related to the IRP process.

Category Participant Assumption Comment NS Power Response 13. Sustaining SBA Revised assumptions included significant changes to The more significant change in basis of presentation was Capital sustaining capital forecast for coal, CTs and...

AI summary The document discusses revisions to sustaining capital forecasts for coal, CTs, and small hydro, as well as the need for realistic assumptions regarding wind and solar integration strategies and costs. NS Power responded to these points, noting changes in financial assumptions and suggesting a technology conference to explore integration options.

ystem deliverable. operations (NS/NB); better integration w/ NE market; sub-hourly scheduling and dispatch; real-time forecasts to reflect best practices • Use DR strategies to facilitate wind/solar energy integration (incl. space/H20 heat...

AI summary The text discusses strategies for integrating renewable energy into the grid, including the use of demand response (DR) strategies, curtailment of surplus wind and solar generation, and flexible hydro imports. It also suggests reconsidering the inclusion of VAR support as a key operational parameter, with potential solutions like synchronous condensers.

ova Scotia Power IRP Final Report Appendix H Page 300 of 321 IRP Assumptions – Participant Comments March 11, 2020

AI summary This document is part of the Nova Scotia Power Integrated Resource Plan (IRP) Final Report, specifically Appendix H, which includes participant comments from March 11, 2020. It outlines assumptions made in the IRP process and incorporates feedback from stakeholders.

Category Participant Assumption Comment NS Power Response 14. Renewable Natural Setting required minimum levels for remaining NS Power agrees that these more detailed wind Integration Forces requirements important - synchronous inertia int...

AI summary Natural Forces argue that renewable integration requirements should consider synchronous inertia based on the largest system infeed/outfeed, but NS Power finds it difficult to model this in the IRP and will use static values. They also note that the PSC Stability study models specific contingencies, but additional analyses will be done during the Reliability and Operability phases.

during the Reliability and Operability assessment phases of the IRP modeling plan. 14. Renewable Natural Proposed grid service level limits should be low rather NS Power agrees; resource portfolios with high levels of Integration Forces th...

AI summary The text discusses the importance of considering grid service level limits and the flexibility of renewable resources during the Reliability and Operability assessment phases of the Integrated Resource Plan (IRP) modeling plan. NS Power agrees with the approach and emphasizes the need to analyze variable generation's contribution to ancillary services and grid reliability.

grid services • Widening supply base successful (demand side contribution to s/t operating reserves) 19 Nova Scotia Power IRP Final Report Appendix H Page 301 of 321 IRP Assumptions – Participant Comments March 11, 2020

AI summary The document discusses the success of widening the supply base through demand side contributions to short-term operating reserves as part of the Integrated Resource Plan (IRP) Final Report by Nova Scotia Power. It references participant comments and is part of an appendix from March 11, 2020.

a Scotia Power IRP Final Report Appendix H Page 301 of 321 IRP Assumptions – Participant Comments March 11, 2020

AI summary The text references the Nova Scotia Power Integrated Resource Plan (IRP) Final Report, specifically Appendix H, page 301 of 321, and mentions participant comments dated March 11, 2020.

Category Participant Assumption Comment NS Power Response 15. Natural Treatment of interconnectors critical. NS Power agrees that additional transmission Interconnection Forces Firm imports could support transition to lower GHG interconnec...

AI summary The text discusses concerns regarding interconnection and transmission and distribution (T&D) systems, including the impact of interconnectors on renewable energy integration and the limitations of the Integrated Resource Plan (IRP) in considering substation-level capacity. NS Power acknowledges the importance of interconnections and has included additional assumptions to support renewable integration.

acity The IRP model does not consider the Distribution system Interconnection Centre considerations (some of which have Transmission explicitly however NS Power will be considering a & T&D restraints as well). methodology for avoided T&D c...

AI summary The IRP model currently does not account for distribution system considerations, although NS Power plans to develop a methodology for avoided T&D costs as part of the IRP process. Most electrification is expected to occur at the end of the line, adding load to substations, and a range of distribution-scale energy and capacity assumptions (1-10MW) should be considered.

tia Power IRP Final Report Appendix H Page 302 of 321 IRP Scenarios and Modeling Plan – Participant Comments March 11, 2020

AI summary This document is a page from the Nova Scotia Power Integrated Resource Plan (IRP) Final Report Appendix H, discussing the IRP Scenarios and Modeling Plan, with participant comments dated March 11, 2020.

Category Participant Comment NSP Response 1.0 Analysis Plan E1 – Feb 14 2020 Clarify at what steps plans are assessed for removal Please refer to the final Scenarios and General from consideration Modeling Plan for additional details on th...

AI summary The E1 – Feb 14 2020 participant requests clarification on the steps for assessing plans for removal from consideration, the data relationship among long-term strategy, roadmap, and action plan, and the process for reassessing plans if emissions regulations become more stringent after the Integrated Resource Plan (IRP). NSP responds by referring to the final Scenarios and Modeling Plan and explains that qualitative and quantitative results from modeling phases will inform the Roadmap and Action Plan.

profiles that are SDGA compliant and more stringent than current emissions limits. 1.1 Analysis Plan E1 – Feb 14 2020 How will evaluation criteria be measured, when will NS Power confirms that NPV of Revenue Evaluation Criteria resource pl...

AI summary The document outlines the evaluation criteria for resource plans, focusing on how they will be measured and screened. NS Power confirms that the Net Present Value (NPV) of Revenue Requirement will be the primary metric used to score candidate resource plans for a specific modeling scenario.

which candidate resource plans are scored for a particular modeling scenario. NS Power also considers other factors to be important which is why additional metrics have been proposed for qualitative consideration during the preparation of...

AI summary The document discusses how candidate resource plans are scored under specific modeling scenarios and mentions that NS Power considers additional metrics for qualitative evaluation in the Roadmap and Action Plan. It also references the evaluation criteria used in the 2020 Integrated Resource Plan (IRP), including the 10-year Net Present Value (NPV) revenue requirement.

Power IRP Final Report Appendix H Page 303 of 321 IRP Scenarios and Modeling Plan – Participant Comments March 11, 2020

AI summary This document is part of the Integrated Resource Plan (IRP) Scenarios and Modeling Plan from the Power IRP Final Report, dated March 11, 2020, and is located on page 303 of 321. It outlines participant comments related to the IRP scenarios and modeling plan.

document. 1.5 Analysis Plan E1 – Feb 14 2020 Confirm if possible to combine plan robustness with Due to the number of potential sensitivities Evaluation Criteria 25-year NPV by assessing NPV rev req under high and requested by stakeholders...

AI summary The document discusses the analysis plan for evaluating the robustness of resource plans, including the use of sensitivity analysis and stochastic analytics to assess financial risks and uncertainties. Nova Scotia Power (NSP) responds to stakeholder feedback on combining robustness with 25-year NPV calculations.

the qualitative evaluation of a given resource plan’s flexibility. 3 Nova Scotia Power IRP Final Report Appendix H Page 305 of 321 IRP Scenarios and Modeling Plan – Participant Comments March 11, 2020

AI summary The document discusses the qualitative evaluation of a resource plan’s flexibility within the context of Nova Scotia Power's Integrated Resource Plan (IRP) scenarios and modeling plan, as presented in the final report appendix.

otia Power IRP Final Report Appendix H Page 305 of 321 IRP Scenarios and Modeling Plan – Participant Comments March 11, 2020

AI summary The document references Nova Scotia Power's Integrated Resource Plan (IRP) Final Report Appendix H, specifically Page 305 of 321, which discusses IRP Scenarios and Modeling Plan and includes participant comments from March 11, 2020.

Category Participant Comment NSP Response 1.8 Analysis Plan CA - Resource Insight Add qualitative resiliency metric considering how NS Power has added this consideration as Evaluation Criteria leading portfolio alternative perform in two r...

AI summary The document discusses the addition of a qualitative resiliency metric in the analysis plan and the evaluation of 'spliced' scenarios to test portfolio resilience. NS Power has incorporated these considerations into their scenarios and modeling plan.

so each NS Power does not believe it would be General portfolio tested under all scenarios. valuable to test all portfolios under all scenarios, as some may be incompatible (e.g. resource plan developed for a particular scenario may not be...

AI summary NS Power is considering the evaluation of different scenarios in its Integrated Resource Plan (IRP), acknowledging that testing all portfolios under all scenarios may not be feasible due to incompatibility. The company will focus on scenarios showing commonality or significant interest and include a qualitative metric for plan robustness.

ferent Revenue Requirement associated with scenarios do not compete against each other] serving different electrification scenarios. Since utility costs of electrification will not be accounted for in revenue requirement, inappropriate to...

AI summary The text discusses the evaluation of different electrification scenarios and their impact on revenue requirements and resource strategies. It emphasizes that scenarios serving different electrification goals should not be compared directly due to differences in utility costs and assumptions.

al disaster or sudden evaluate a broad range of potential carbon shifts outcomes during the IRP process. NS Power has also added Resiliency considerations as part of the qualitative evaluation of Plan Robustness included in the final Scena...

AI summary The document discusses the integration of resiliency considerations in the Integrated Resource Plan (IRP) process, as well as the exclusion of avoided transmission and distribution (T&D) costs from the IRP model. Nova Scotia Power (NSP) has included qualitative evaluations of plan robustness in the Scenarios and Modeling Plan document.

tia Power IRP Final Report Appendix H Page 307 of 321 IRP Scenarios and Modeling Plan – Participant Comments March 11, 2020

AI summary The document references the IRP Scenarios and Modeling Plan from Nova Scotia Power's Final Report, with participant comments submitted on March 11, 2020.

Category Participant Comment NSP Response 2.2 Scenarios E1 – March 6 2020 Avoided T&D costs part of separate process; NSP to Please see above Drivers calculate avoided T&D costs on narrower set of Load portfolios. Avoided T&D Confirm avoid...

AI summary The document discusses the calculation of avoided transmission and distribution (T&D) costs, modeling of municipal electrical utilities, and the selection of electrification scenarios. NSP responds to these issues by referencing previous load forecasts and stating that multiple scenarios will be evaluated with stakeholder input.

Stakeholder input evaluate a broad range of potential outcomes during the IRP process. 2.2 Scenarios Digby Transmission grid (69 kV line) from Tremont to The capacity expansion modeling of the IRP Drivers Yarmouth impedes area’s ability to...

AI summary The document discusses stakeholder input on scenarios for the Integrated Resource Plan (IRP), including transmission grid constraints, electrification of buildings and transportation, and the impact of electrification scenarios on load forecasts and long-term energy requirements.

of both peak and energy requirements. 2.2 Scenarios E1 – March 6 2020 Confirm Pathways agnostic regarding costs, Confirmed Drivers mechanisms and delivery entities for electrification Load 6 Nova Scotia Power IRP Final Report Appendix H Pa...

AI summary The document discusses the IRP scenarios and modeling plan, with participants commenting on the need to pair DSM potential study scenarios with electrification scenarios due to data complexity. NSP responds that they cannot test all DSM profiles across all modeling scenarios.

2.2 Scenarios CA - Resource Insight Test all 4 DSM levels across all scenarios Due to the complexity of modeling NS Power Drivers is not able to test all DSM profiles across all Load modeling scenarios. Please see the Scenario and Modeling...

AI summary The document discusses the modeling of different scenarios for demand-side management (DSM) and electrification, including challenges in testing all DSM profiles across scenarios and adjustments to candidate scenarios, such as accelerated carbon reduction targets and higher industrial/marine demand.

High electrification logical w/ coal phase-out of scenarios in the IRP modeling in order to capture the uncertainty of potential futures. Pathways excluded industrial & marine sectors from electrification or other load growth drivers but T...

AI summary The document discusses the integration of high electrification scenarios in the Integrated Resource Plan (IRP) modeling, including the exclusion of industrial and marine sectors from electrification in some pathways. It also addresses the potential for retiring coal units when economically viable and the testing of early coal closure strategies.

Scotia Power IRP Final Report Appendix H Page 309 of 321 IRP Scenarios and Modeling Plan – Participant Comments March 11, 2020

AI summary The document is a page from the final report of the Integrated Resource Plan (IRP) by Scotia Power, specifically Appendix H, discussing IRP scenarios and the modeling plan. It is part of a submission dated March 11, 2020, and includes participant comments.

Category Participant Comment NSP Response 3.1 Screening Dalhousie Need to show how grid resiliency modelled in Applicable reliability targets will be met by Reliability scenarios viable resource portfolios. Transmission & Distribution cons...

AI summary The document discusses grid resiliency modeling and reliability targets, noting that the IRP model does not account for location-specific storm hardening. It also addresses the evaluation of resource strategies under the Comparator case, with NS Power arguing that non-compliance with the SDGA makes additional strategies unnecessary.

which combines a Low Electrification load with an SDGA compliant GHG trajectory which will be tested against both the Current Landscape and Regional Integration resource strategies. 5.0 Portfolios E1 – February 14 2020 Request a preferred...

AI summary The document discusses the need for a preferred resource plan (PRP) as part of the 2014 Integrated Resource Plan (IRP), emphasizing the importance of selecting an electrification scenario based on likelihood and stakeholder input. It also references the Sustainable Development Goals Act (SDGA) and GHG trajectory compliance.

from within the ‘most likely’ electrification scenario. E1 believes the above to represent a fair and transparent means of PRP selection.” This appears to be a reasonable approach and will continue to discuss with stakeholders as the model...

AI summary The text discusses the selection process for the PRP (Power System Committee) within the context of the Integrated Resource Plan (IRP) modeling phase. E1 supports the approach as fair and transparent, and further discussions with stakeholders are planned as modeling progresses.

otia Power IRP Final Report Appendix H Page 310 of 321 IRP Scenarios and Modeling Plan – Participant Comments March 11, 2020 Category Participant Comment NSP Response 6.4 Sensitivities CA - Resource Insight No new emitting might be better...

AI summary The document discusses sensitivities in the Integrated Resource Plan (IRP) modeling, with Participant Resource Insight suggesting testing new emitting resources as a sensitivity rather than a distinct strategy. NS Power agrees and has adjusted the final scenarios. Another sensitivity considered is the pricing for power exported from Nova Scotia, with NS Power noting that export prices may be depressed during peak generation periods due to correlation with neighboring jurisdictions.

in neighbouring jurisdictions, depressing any export prices. 9 Nova Scotia Power IRP Final Report Appendix H Page 311 of 321 2020 IRP SCENARIOS AND MODELING PLAN FEBRUARY 27, 2020 Nova Scotia Power IRP Final Report Appendix H Page 312 of 3...

AI summary The document outlines the 2020 Integrated Resource Plan (IRP) modeling process, including scenario analysis, reliability and operability screening, and post-modeling strategy development. It emphasizes the extraction of findings to inform long-term and near-term planning.

in order to develop: Near-term Action Plan 2020 IRP SCENARIOS AND MODELING PLAN 1 Nova Scotia Power IRP Final Report Appendix H Page 313 of 321 PORTFOLIO STUDY SCENARIO DEVELOPMENT APPROACH Portfolios (“Resource Plans”) Scenarios Optimal p...

AI summary The document outlines a portfolio study scenario development approach for the 2020 Integrated Resource Plan (IRP), including different scenarios (A and B) and their influencing factors. It emphasizes the need to consider major uncertainties and develop optimal resource plans based on various drivers and combinations.

Scenario A Driver 1 Scenario B X Driver 2 B1 B2 B3 C1 C2 C3 Scenario C Driver 3 D1 D2 D3 Scenario D Variations such as resource costs or focus Variations likely focused on on specific resource Sensitivity Analysis coal closure timing, type...

AI summary The document outlines different scenarios (A, B, C, D) and their drivers, focusing on variations such as coal closure timing, electricity load, and carbon emission reduction levels. It also mentions sensitivity analysis and impact testing related to the 2020 Integrated Resource Plan (IRP) and the modeling plan.

(58% reduction (78% reduction (90% reduction (100% reduction Reduction to 0 Mt by 2050 from 2005) from 2005) from 2005) from 2005) 2020 IRP SCENARIOS AND MODELING PLAN 3 Nova Scotia Power IRP Final Report Appendix H Page 315 of 321 KEY POL...

AI summary The text presents scenarios and modeling plans from the 2020 Integrated Resource Plan (IRP) by Nova Scotia Power, focusing on key policy drivers such as greenhouse gas emissions reduction targets and coal closure policies. It outlines different scenarios for load changes, electrification, and energy efficiency measures.

20 IRP SCENARIOS AND MODELING PLAN 5 Nova Scotia Power IRP Final Report Appendix H Page 317 of 321 KEY SCENARIOS 2050 GHG (MT) Load Driver Coal Closure Comparator Case 2.1 BAU 2040 Net Zero – High Electrification 1.0 High Elec. 2040 Net Ze...

AI summary The document outlines several key scenarios for the Integrated Resource Plan (IRP), including different levels of electrification and coal closure timelines, aiming towards net zero GHG emissions by 2050. Additional scenarios are proposed for analysis using the RESOLVE model.

IRP SCENARIOS AND MODELING PLAN 6 Nova Scotia Power IRP Final Report Appendix H Page 318 of 321 RESOURCE STRATEGIES Distributed No New Emitting Current Landscape Regional Integration Resources Promoted Resources • New In-Province • Distrib...

AI summary The document outlines resource strategies and modeling plans for the Integrated Resource Plan (IRP), emphasizing the promotion of distributed resources and the prioritization of non-emitting resources. It highlights the importance of evaluating key areas of interest in the IRP analysis.

OS & Nova Scotia Power IRP Final Report Appendix H Page 319 of 321 STRATEGIES Scenario Resource Strategy Comparator Case Current Landscape Net Zero – High Electrification Current Landscape Net Zero – High Electrification Distributed Resour...

AI summary The text outlines preliminary modeling runs for the Integrated Resource Plan (IRP) Final Report, including scenarios such as 'Net Zero – High Electrification' and 'Absolute Zero World.' These runs will be conducted using Plexos LT and E3’s RESOLVE model to assess various strategies and their impacts.

SENSITIVITY ANALYSIS Increase in Low capital Renewable Energy cost of Standard policy wind Low capital Low pricing of import cost of energy storage High High pricing of pricing of natural gas import energy Carbon Fuel security tax/pricing...

AI summary The document outlines a sensitivity analysis focusing on renewable energy standards, capital costs, and pricing of imported energy, as well as carbon tax and fuel security. It also proposes evaluation criteria for an integrated resource plan, emphasizing the minimization of revenue requirements and rate impacts over a 25-year period.

ar NPV Revenue Requirement annual revenue requirements over the planning horizon (adjusted for end-effects) Magnitude and timing of electricity rate effects 10 year NPV Revenue Requirement Reliability requirements for supply adequacy Evalu...

AI summary This document outlines the 2020 Integrated Resource Plan (IRP) interim modeling progress and includes participant comments and responses from Nova Scotia Power. It discusses reliability requirements, plan robustness, greenhouse gas reduction, and flexibility in decision-making.

Advocate NS Power Responses to Participant Comments 37 Nova Scotia Power IRP Final Report Appendix I Page 2 of 44 2020 IRP INTERIM MODELING PROGRESS WORKSHOP APRIL 28, 2020 Nova Scotia Power IRP Final Report Appendix I Page 3 of 44 AGENDA...

AI summary The document outlines the progress made by Nova Scotia Power (NSP) in the 2020 Integrated Resource Plan (IRP) interim modeling update. It includes updates on the process, key assumptions, policy drivers, and the status of modeling work, including the Terms of Reference, Scenario Development, and Supply Options Study.

Terms of Reference Capacity Study Scenario Development Supply Options Study Modeling Plan Demand Response Assumptions Assumptions Stability Study Modeling Previously completed Analysis/Conclusions Completed since last update Report, Roadma...

AI summary The text outlines the structure and components of the Integrated Resource Plan (IRP) update, including studies, modeling plans, and progress tracking. It references the 2020 IRP Interim Modeling Update and mentions the final report and appendix.

E L I N G U P D AT E 2 Nova Scotia Power IRP Final Report Appendix I Page 5 of 44

AI summary The document is the final report of the Integrated Resource Plan (IRP) by Nova Scotia Power, including Appendix I on page 5 of 44.

KEY ASSUMPTIONS & POLICY DRIVERS • NS Power has developed assumptions for all major inputs to the IRP model: • Financial • Environmental • Load • Demand Response • Demand Side Management • Imports & Transmission Environmental Policy • Supp...

AI summary NS Power has developed a comprehensive set of assumptions for the Integrated Resource Plan (IRP) model, covering financial, environmental, load, demand response, and supply options. These assumptions include GHG scenarios, coal unit retirements, and stakeholder input, allowing the IRP to analyze sensitivity and build insights for monitoring resource plans.